DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and ntm

DIOPT Version :10

Sequence 1:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:280 Identity:65/280 - (23%)
Similarity:110/280 - (39%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQN--PISQRVQCMLNN----SILLRNVSP 137
            |..:.||..||.|...|  ....|.|.....|:..|.:  .|..||..:.|.    ||.::||..
 Frog    46 VTVRQGDSAILRCTVDN--RVTRVAWLNRSTILYTGNDKWSIDPRVVLLANTKSQYSIEIQNVDI 108

  Fly   138 EDSDDYYCEIL----PQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNA 198
            .|...|.|.:.    |:..|.|..::|..|:.      ||:. |....:|.:..|.|........
 Frog   109 YDEGPYTCSVQTDNHPKTSRVHLIV
QVPPRIV------DISS-SIAVNEGSNVSLICIANGRPEP 166

  Fly   199 TIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTH 263
            .:.|.:  |:.:.....:::..:.:..:..:.:|.|:|.|.:....|....|.:.|.|.|.: ..
 Frog   167 VVNWRY--LSPKARGFVSEDEYLEITGITREQSGIYECSASN
DVSAPDVRRVKLTVNYPPYI-LD 228

  Fly   264 RHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKY-SLKDSVHNDHNRTTLIVREVTDS 327
            ..|:....|....|.|...|.|....::.|:.|  :|||.: .:|.......:|.|.:  .|::.
 Frog   229 AQNIGAPLGHRGILQCEASAVPAADFFWYKEDK--RLSDSWRGVKVENRETISRVTFL--NVSEQ 289

  Fly   328 DLGEYLCQVENAIGSNEVKV 347
            |.|.|.|..:|.:|.:...:
 Frog   290 DYGNYTCMAKNLLGHSNASI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 21/72 (29%)
Ig_3 173..238 CDD:464046 10/64 (16%)
Ig 258..349 CDD:472250 22/91 (24%)
Ig strand B 275..279 CDD:409353 1/3 (33%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 317..321 CDD:409353 1/3 (33%)
Ig strand F 331..336 CDD:409353 2/4 (50%)
ntmXP_004916061.1 Ig 45..133 CDD:472250 25/88 (28%)
Ig strand B 54..58 CDD:409353 2/3 (67%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 2/3 (67%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 126..129 CDD:409353 0/2 (0%)
Ig_3 136..206 CDD:464046 13/78 (17%)
ig 227..311 CDD:395002 21/87 (24%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.