| Sequence 1: | NP_001286718.1 | Gene: | CG13506 / 37556 | FlyBaseID: | FBgn0034723 | Length: | 503 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038957463.1 | Gene: | Kirrel2 / 100359836 | RGDID: | 1308456 | Length: | 711 | Species: | Rattus norvegicus |
| Alignment Length: | 310 | Identity: | 57/310 - (18%) |
|---|---|---|---|
| Similarity: | 109/310 - (35%) | Gaps: | 86/310 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 79 VEAKPGDDVILNCDAR-NFQLSNAVVWYKNRIIIANG----QNPISQRVQCMLNNSILLRNVSPE 138
Fly 139 DSDDYYCEILPQRVRQHTALRVGARLSILCDDR-----DITDRSQTFRQGDHHKLECR-TYLPDN 197
Fly 198 ATIKWSFNDLNG----------------------QPSSVDNQNGVIILDNVDEKNAGDYQCLADD 240
Fly 241 GSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYS 305
Fly 306 LKDSVHNDHNRTTLIVREVTDSDLGEYLCQVE---NAIGSNEVKVHVSYN 352 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13506 | NP_001286718.1 | IG_like | 79..146 | CDD:214653 | 14/71 (20%) |
| IGc2 | 83..146 | CDD:197706 | 13/67 (19%) | ||
| IG_like | 176..254 | CDD:214653 | 14/100 (14%) | ||
| Ig | 176..239 | CDD:299845 | 12/85 (14%) | ||
| I-set | 258..349 | CDD:254352 | 21/93 (23%) | ||
| Ig | 275..348 | CDD:143165 | 17/75 (23%) | ||
| Kirrel2 | XP_038957463.1 | IG_like | 38..127 | CDD:214653 | |
| Ig strand A' | 40..44 | CDD:409353 | |||
| Ig strand B | 48..57 | CDD:409353 | |||
| Ig strand C | 62..66 | CDD:409353 | |||
| Ig strand D | 75..85 | CDD:409353 | |||
| Ig strand E | 88..100 | CDD:409353 | |||
| Ig strand F | 107..115 | CDD:409353 | |||
| Ig strand G | 117..127 | CDD:409353 | |||
| Ig | 133..231 | CDD:416386 | 19/95 (20%) | ||
| Ig strand A | 134..137 | CDD:409353 | |||
| Ig strand A' | 140..144 | CDD:409353 | |||
| Ig strand B | 151..158 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C | 164..169 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 172..174 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 177..184 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 191..199 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 208..216 | CDD:409353 | 1/7 (14%) | ||
| Ig strand G | 222..228 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 234..303 | CDD:404760 | 10/72 (14%) | ||
| Ig strand B | 252..256 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 266..270 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 283..286 | CDD:409353 | 0/2 (0%) | ||
| Ig strand F | 292..301 | CDD:409353 | 2/8 (25%) | ||
| Ig strand G | 309..312 | CDD:409353 | 0/2 (0%) | ||
| Ig | 326..403 | CDD:416386 | 19/89 (21%) | ||
| Ig strand A' | 327..332 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 335..344 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 350..354 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 357..359 | CDD:409353 | 1/1 (100%) | ||
| Ig strand D | 362..365 | CDD:409353 | 2/15 (13%) | ||
| Ig strand E | 366..371 | CDD:409353 | 2/4 (50%) | ||
| Ig strand F | 379..387 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 393..403 | CDD:409353 | 1/9 (11%) | ||
| Ig | 405..509 | CDD:416386 | 57/310 (18%) | ||
| Ig strand A | 406..410 | CDD:409353 | |||
| Ig strand A' | 412..415 | CDD:409353 | |||
| Ig strand B | 423..430 | CDD:409353 | |||
| Ig strand C | 437..442 | CDD:409353 | |||
| Ig strand C' | 444..447 | CDD:409353 | |||
| Ig strand D | 455..462 | CDD:409353 | |||
| Ig strand E | 472..479 | CDD:409353 | |||
| Ig strand F | 490..497 | CDD:409353 | |||
| Ig strand G | 500..507 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||