DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and lrit3b

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:311 Identity:63/311 - (20%)
Similarity:101/311 - (32%) Gaps:105/311 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 RLSILCDDRD----ITDRSQTFR------QGDHHKLECR--TYLPDNATIKWSFNDLNGQPSSVD 215
            |||.|.:|..    .:|.:||.|      |.:....:||  |.|           |::..|.|  
Zfish   195 RLSTLANDLTALWLFSDSNQTQRSFVLGLQDNPWVCDCRLSTLL-----------DISRGPES-- 246

  Fly   216 NQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCN 280
               .:::||..       ..|.........|..:|.:.....|.|.|....:....|:|..|.|.
Zfish   247 ---SLVLLDRF-------LTCSEPLDLAGVPFQSVELSRCRRPYVVTSATKITALLGSTVLLRCE 301

  Fly   281 YRAKPIGRSYFIKDGKT---------------------------LQLSDKYSLKDSVHNDHNRTT 318
            ....|.....:||..|.                           :|.|.:..::.||        
Zfish   302 ATGHPTPALMWIKSAKRNLYNQGCCKQTQSSLDTERFPKKLFGYVQESPRVGVRWSV-------- 358

  Fly   319 LIVREVTDSDLGEYLCQVENAIGSNEVKVHVSYNPETPQFEDM---------TVEGNKVTLHWLV 374
            :.:..::.||.|||.|:.:|..|.:|..|.::......::.|.         |...:|.|     
Zfish   359 VSLNGISYSDAGEYRCRAQNMAGISEAVVSLNVVGVMAEYTDFKNSDQQQTTTKSDSKRT----- 418

  Fly   375 RSHQLLSEAMLDYQLTGSYTWSTVQVLET-------------------HRH 406
             ..:..|:||:...:|||.: ...:||:|                   |||
Zfish   419 -KPKQKSKAMMPRNMTGSLS-PLKRVLKTPKAGRDKMKRDRTAVQKLSHRH 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653
IGc2 83..146 CDD:197706
IG_like 176..254 CDD:214653 16/85 (19%)
Ig 176..239 CDD:299845 14/70 (20%)
I-set 258..349 CDD:254352 25/117 (21%)
Ig 275..348 CDD:143165 19/99 (19%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378
LRR_8 160..214 CDD:290566 6/18 (33%)
LRR_4 160..201 CDD:289563 4/5 (80%)
leucine-rich repeat 162..185 CDD:275378
leucine-rich repeat 186..199 CDD:275378 3/3 (100%)
leucine-rich repeat 215..230 CDD:275378 3/14 (21%)
Ig 278..391 CDD:299845 25/120 (21%)
I-set 279..391 CDD:254352 25/119 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.