DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and KIRREL3

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:337 Identity:74/337 - (21%)
Similarity:121/337 - (35%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 IEVQLAPQV--LIEPSDLTEQRIGAIFEVVCEAQGVPQPVIT---WRLNGNVIQPQSNTGNRQSL 185
            |::|..|.|  .:||..:.|..:....   |.|:.  .|.:|   |...|.:|:..|....|.::
Human   250 IDIQHPPLVNLSVEPQPVLEDNVVTFH---CSAKA--NPAVTQYRWAKRGQIIKEASGEVYRTTV 309

  Fly   186 ILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPA 250
            .....|..    :.|..:|.:|...::.. :.|.|.|.::.....:...|||.|...|.....|:
Human   310 DYTYFSEP----VSCEVTNALGSTNLSRT-VDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPS 369

  Fly   251 ATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRA-SNQIS 314
            .|:.|...|..|.|....|                      |.:||||..|.|:|.||| ..::.
Human   370 LTIVWMKRGSGVVLSNEKT----------------------LTLKSVRQEDAGKYVCRAVVPRVG 412

  Fly   315 VKSGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESLLPIMEFKLKFRQIPSNNVTRQVRTNWT 379
            .....|.||....|.:      :.:.|.|.|..:..      :.|...|..|..:   ::..:|.
Human   413 AGEREVTLTVNGPPII------SSTQTQHALHGEKG------QIKCFIRSTPPPD---RIAWSWK 462

  Fly   380 ELTIPAQATNGLI----------YITTYTLHGLQPASLYEV-SVLARNSFGWSDNSKIVRFATGG 433
            | .:....|:|..          .|:|.|:..:..|....: :..|.||||  .:::|:|....|
Human   463 E-NVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFG--SDTEIIRLKEQG 524

  Fly   434 EVELPNYSTESE 445
            .........|:|
Human   525 SEMKSGAGLEAE 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845
IG_like 41..118 CDD:214653
IG_like 145..218 CDD:214653 13/75 (17%)
Ig 147..219 CDD:299845 13/74 (18%)
I-set 224..323 CDD:254352 24/99 (24%)
IGc2 236..314 CDD:197706 22/78 (28%)
FN3 339..431 CDD:238020 21/102 (21%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352
Ig2_KIRREL3-like 171..252 CDD:143236 1/1 (100%)
Ig_2 260..337 CDD:290606 16/86 (19%)
I-set 341..422 CDD:254352 26/102 (25%)
IGc2 355..406 CDD:197706 20/72 (28%)
Ig5_KIRREL3 424..521 CDD:143306 22/114 (19%)
IG_like 432..521 CDD:214653 21/100 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.