DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and DIP-epsilon

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:354 Identity:95/354 - (26%)
Similarity:148/354 - (41%) Gaps:48/354 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLLAALI-----------LGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRY 64
            ||:|:.:           .|.|... ..||.:....:|..:...:.......|:|.|::.....|
  Fly    18 CLIASSVALSTDTGSEGNAGNVGGS-TLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSY 81

  Fly    65 -VRW-HRDDVAL------VDSRHPEL----PPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDS 117
             |.| |.:..|:      |.:|:|.:    ...|:...|   .|.:.|||..|.|.|.|::|:.:
  Fly    82 KVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTW---FLHINNVQEEDRGRYMCQINTVT 143

  Fly   118 GHVVQQHAIEVQLAPQV--LIEPSDLTEQRIGAIFEVVCEAQGVPQPVITW-RLNGN--VIQPQS 177
            .. .|...::|.:.|.:  .:..||:. .|.|....:.|:|:|.|:|.|.| |.:||  ||....
  Fly   144 AK-TQYGFVKVVVPPNIDDALTSSDII-VREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTL 206

  Fly   178 NTGNRQ--SLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAH 240
            ...:.:  ||.||..||...|...|:|||||.......:.:.|.|||.|.||..:|...:|....
  Fly   207 EVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNIT 271

  Fly   241 LECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQY 305
            |||.:||.|.:...|...      .....|..|:.:|.....|........|.:.:|:::|.|.|
  Fly   272 LECFIEANPTSLNYWTRE------NDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNY 330

  Fly   306 ECRASNQISVKSGSVEL------TGRPMP 328
            :|.|.|......|:::|      |.:|.|
  Fly   331 KCVAKNPRGDMDGNIKLYMSSPPTTQPPP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 22/88 (25%)
Ig strand B 52..56 CDD:409353 2/3 (67%)
Ig strand C 64..68 CDD:409353 3/5 (60%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 133..219 CDD:472250 29/92 (32%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 2/4 (50%)
Ig strand E 183..187 CDD:409353 2/5 (40%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 24/88 (27%)
FN3 339..431 CDD:238020
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 24/99 (24%)
Ig strand B 69..73 CDD:409353 2/3 (67%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 2/9 (22%)
Ig 157..249 CDD:472250 30/92 (33%)
Ig strand B 176..180 CDD:409289 0/3 (0%)
Ig strand C 189..193 CDD:409289 1/3 (33%)
Ig strand E 213..218 CDD:409289 2/4 (50%)
Ig strand F 228..233 CDD:409289 1/4 (25%)
Ig strand G 242..245 CDD:409289 0/2 (0%)
IG_like 267..348 CDD:214653 21/86 (24%)
Ig strand C 283..287 CDD:409394 0/3 (0%)
Ig strand E 313..319 CDD:409394 1/5 (20%)
Ig strand F 329..334 CDD:409394 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.