DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and DIP-delta

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:468 Identity:115/468 - (24%)
Similarity:184/468 - (39%) Gaps:86/468 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IPTTVKTYENDTVQLPCTLNTPFRY-VRW-HRD-DVALVDSRHPELPPPDRIMLWPNGS--LQVA 99
            ||........| ..|||.:.....| |.| |.| .:.|...||.....|...:.:.:.:  |.|.
  Fly    50 IPNVTVAVGRD-ANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVN 113

  Fly   100 NVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVL-IE--PSDLT---EQRIGAIFEVVCEAQG 158
            .....|.|.|.|::|::. .:.|...::|.:.|.:| ||  ||.:.   .|.|    .:.|.|.|
  Fly   114 QAHQDDRGYYMCQVNTNP-MISQVGYLQVVVPPNILDIESTPSSVAVRENQNI----NMTCRADG 173

  Fly   159 VPQPVITWRL-NGNVIQPQSNTGNRQSLILEIK-------SRNQAGLIECVASNGVGEPAVANVY 215
            .|.|.|.||. :|..|..:.   .::.|:.:..       |||:.|...|:|:|||.......:.
  Fly   174 FPAPKIIWRREDGEEIAVEK---KKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRII 235

  Fly   216 LHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRS 280
            |.|.|||.:.:|..:|....|:...::|..||.|.|.:.|.::.:.|.......|          
  Fly   236 LDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKT---------- 290

  Fly   281 VDHYVNAVR-HM-LVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSH 343
             |:..|:.| || |.:::::..|.|.|.|.:.|.:....||:.:...|:|.    .|..|  .:|
  Fly   291 -DYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPS----TPSKQ--VTH 348

  Fly   344 VLVWQTESLLPIMEFKLKFRQIPS--NNVTRQVRTNWTELTIPAQATNGLIYITTYTL-HGLQPA 405
            ..|...|:.:           |||  |:.|:.::|:                 ..|.: :.|.|.
  Fly   349 TTVESRENNI-----------IPSSRNDTTKSLQTD-----------------VGYAMKNDLYPG 385

  Fly   406 SLYEVSVLARNSFGWSDNSKIVRFATGGEV--ELPNYSTESEL---QDDFTEEDFHNEITQRSE- 464
            |....|....:|...|.:|.......||..  .|.:..::..|   :..|..|...||....|. 
  Fly   386 SASSSSSGGSSSAASSSSSMQTSALPGGVAGNSLSSMGSKGSLAIGKSTFYTERPPNEYAASSVA 450

  Fly   465 --VLSASMMFNSG 475
              :|..:::|.||
  Fly   451 GLLLHRALLFGSG 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 22/87 (25%)
IG_like 41..118 CDD:214653 21/81 (26%)
IG_like 145..218 CDD:214653 22/80 (28%)
Ig 147..219 CDD:299845 21/79 (27%)
I-set 224..323 CDD:254352 24/100 (24%)
IGc2 236..314 CDD:197706 20/79 (25%)
FN3 339..431 CDD:238020 17/94 (18%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 23/93 (25%)
Ig 145..238 CDD:416386 29/99 (29%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 2/10 (20%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 0/5 (0%)
Ig strand F 216..223 CDD:409353 2/6 (33%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 25/101 (25%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 2/14 (14%)
Ig strand E 295..305 CDD:409353 5/9 (56%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.