DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dscama

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:453 Identity:104/453 - (22%)
Similarity:173/453 - (38%) Gaps:84/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QVQAELDFNNDLENSQKFKSIPTTVKTYE------NDTVQLPCTLNT---PFRYVRWHRDDVALV 75
            |||.:|..|..:..:.|   :|..::.:|      ...|.:||.:.:   |.. :.|.:|..::.
Zfish   579 QVQPQLFKNQSVHVTVK---VPPFIQPFEFPRYSIGHRVFVPCVVRSGDLPIS-ITWEKDGKSIN 639

  Fly    76 DSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSD 140
            .|....:   |.|..  ..||:::|:|....|.|.|...:|:..|..|..:.|::.|:..::|.|
Zfish   640 ASLGVTI---DNIDF--TSSLRISNLQRVHNGTYTCIAQNDAAVVKYQSQLIVRVPPRFKVQPQD 699

  Fly   141 LTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQ-----SNTGNR------QSLILEIKSRNQ 194
             .:...|....:.|.|.|.|:|.|.|:.:.....||     .|:|.|      .||:::......
Zfish   700 -QDGIYGKSVILNCSADGEPRPTIEWKYSKGAGVPQFQPIALNSGFRVQLLGNGSLLIKHVLEED 763

  Fly   195 AGLIECVASNGVGEPAVANVYLHVLFSPEV-SIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHH 258
            ||...|..||.||.....::||:|.....: |.|...:.|| |.:..:.|.........|:|   
Zfish   764 AGYYLCKVSNDVGADVSKSMYLNVKIPAMITSYPNNSLATK-GEKIEMSCKAHGEKPIMVRW--- 824

  Fly   259 GLPVALGAHSTTHESELQTNRSVDHYVN--AVRHMLVVKSV-------------RNADMGQYECR 308
                         |.|::..:. .|.:|  ..||.:.||:|             ...|.|.:.|.
Zfish   825 -------------EKEVEKEKQ-SHMINPDMWRHTVTVKNVGDEVVSTLQIYPTMREDSGFFSCH 875

  Fly   309 ASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSHVLVW----QTESLLPIMEFKLKFRQIPSNN 369
            |.|......|.::||.:..|...|:........:..|.|    ...||:...:.:.|        
Zfish   876 AINSYGEDRGILQLTVQEPPEPPKVEIREVKERTIALRWTMGFDGNSLITGYDIECK-------- 932

  Fly   370 VTRQVRTNWTELTIPAQATNGLI-YITTYTLHGLQPASLYEVSVLARNSFGWSDNSKIVRFAT 431
                   |.||....|:.|..:. .:...|:..|.|:|.|.:.:.|:|..|.|:.|..:...|
Zfish   933 -------NKTETWERARRTRDVSPTLNQATIIELHPSSTYNIRMFAKNHIGDSEPSNELTVTT 988

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 20/91 (22%)
IG_like 41..118 CDD:214653 19/85 (22%)
IG_like 145..218 CDD:214653 24/83 (29%)
Ig 147..219 CDD:299845 24/82 (29%)
I-set 224..323 CDD:254352 23/114 (20%)
IGc2 236..314 CDD:197706 18/92 (20%)
FN3 339..431 CDD:238020 20/96 (21%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352
IG_like 321..402 CDD:214653
I-set 408..502 CDD:333254
IGc2 524..579 CDD:197706 104/453 (23%)
Ig 614..679 CDD:319273 17/70 (24%)
Ig_DSCAM 708..787 CDD:143211 23/78 (29%)
Ig 805..898 CDD:325142 22/109 (20%)
FN3 894..988 CDD:238020 22/108 (20%)
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.