DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr12

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:268 Identity:56/268 - (20%)
Similarity:96/268 - (35%) Gaps:95/268 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDL----TEQRIGAIF 150
            ||..|.:         .||...:.|.||             :...:.|.|:|    |..::|...
  Fly    53 LWMRGGI---------NGDSKLDNNLDS-------------SDSPMFEDSELMAHNTTVQLGGTA 95

  Fly   151 EVVCEAQGVPQPVITW-------RLNGNVIQ--PQSNTGNRQSLI----------LEIK--SRNQ 194
            .:||:..||.:..:.|       |.:.:::.  .|..|.:.:..|          |:||  .|..
  Fly    96 FLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRD 160

  Fly   195 AGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVV------YTKLGSRAHLECIVEAAPAAT- 252
            .|:.||..|...|      :..|.: :.:|.:|:..:      :..:||..:|.||:|.:|... 
  Fly   161 HGMYECQVSTPTG------IISHFV-NLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQ 218

  Fly   253 -VKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHM-------------LVVKSVRNADMG 303
             |.|                    |.|..:.:||::.|.:             |:::..:..|.|
  Fly   219 YVYW--------------------QKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSG 263

  Fly   304 QYECRASN 311
            .|.|.|||
  Fly   264 NYTCSASN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 8/33 (24%)
IG_like 41..118 CDD:214653 7/27 (26%)
IG_like 145..218 CDD:214653 19/93 (20%)
Ig 147..219 CDD:299845 20/92 (22%)
I-set 224..323 CDD:254352 24/109 (22%)
IGc2 236..314 CDD:197706 22/91 (24%)
FN3 339..431 CDD:238020
dpr12NP_652462.3 IG 86..183 CDD:214652 21/103 (20%)
Ig_3 193..271 CDD:404760 20/97 (21%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 2/23 (9%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.