DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and opcml

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:322 Identity:76/322 - (23%)
Similarity:137/322 - (42%) Gaps:47/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TVKTYENDTVQLPCTLNTPFRYVRW-HRDDVALVDSRHPELPPPDRIMLWPNG----SLQVANVQ 102
            ||:  :.|:..|.|:::.....|.| :|..:....:....|.|  |::|....    |:::.||.
Zfish    43 TVR--QGDSAVLKCSMDNKVSRVAWLNRTTILFTGNEKWSLDP--RVVLLNTAVNEYSIKILNVN 103

  Fly   103 SSDTGDYYCE-MNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITW 166
            ..|.|.|.|. :.:......:.|.| ||:..:::...:|::... |:...::|.|.|.|:|.|.|
Zfish   104 LYDEGPYVCSILTNKKPESTKVHLI-VQVPARIVNVSTDVSVNE-GSNVSLMCLAIGRPEPSILW 166

  Fly   167 RLNGNVIQPQSNTGNR---QSLILEIK--SRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSI 226
            :.       :|:.|||   :...:|:.  :::.:|..:|:.||.:..|.|..|.:.|.:.|.:|.
Zfish   167 KF-------RSSKGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQV
TVNYPPVISR 224

  Fly   227 PQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHM 291
            .:. ..|.:|.:..|.|...|.|.|..:||.....:..|.:....|::            ..:.|
Zfish   225 ARS-TGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNGVKIENK------------GKQSM 276

  Fly   292 LVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESLL 353
            |...:|...|.|.|.|.|.|.:.:.:.|:.|.|          ||.....::..:..|.|||
Zfish   277 LTFFNVSEEDYGNYTCVAINTLGITNASIILY
G----------PGAIHDVNNAALSPTCSLL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 19/80 (24%)
Ig strand B 52..56 CDD:409353 1/3 (33%)
Ig strand C 64..68 CDD:409353 2/4 (50%)
Ig strand E 94..98 CDD:409353 1/7 (14%)
Ig strand F 108..113 CDD:409353 2/5 (40%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 21/90 (23%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 1/2 (50%)
Ig_3 222..311 CDD:464046 21/88 (24%)
FN3 339..431 CDD:238020 4/15 (27%)
opcmlNP_001005580.1 Ig 41..129 CDD:472250 21/90 (23%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 62..66 CDD:409353 1/3 (33%)
Ig strand E 95..99 CDD:409353 1/3 (33%)
Ig strand F 109..114 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 128..214 CDD:472250 24/94 (26%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 181..185 CDD:409353 0/3 (0%)
Ig strand F 195..200 CDD:409353 1/4 (25%)
Ig 220..308 CDD:472250 23/100 (23%)
Ig strand B 236..240 CDD:409353 1/3 (33%)
Ig strand C 249..253 CDD:409353 0/3 (0%)
Ig strand E 275..279 CDD:409353 2/3 (67%)
Ig strand F 289..294 CDD:409353 2/4 (50%)
Ig strand G 302..305 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.