DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and negr1

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:358 Identity:88/358 - (24%)
Similarity:138/358 - (38%) Gaps:79/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CSVVRCLLAALILGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTL-----------N 59
            |.:..||.|    ||.   :|:....|          :|.:.:.||..|.|.|           .
Zfish    26 CFLPSCLPA----GQT---VDYTTSSE----------SVVSRQGDTALLRCYLLDGISKGAWLNR 73

  Fly    60 TPFRYV---RWHRDD----VALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDS 117
            :...|.   :|..|.    |:.|..:|             ..|||:..|..:|.|.|.|.:.|:.
Zfish    74 SSIIYAGNDKWSGDPRVSIVSNVGDKH-------------EYSLQIQKVDVTDEGVYTCSIQSER 125

  Fly   118 GHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNT-GN 181
            ....:...:.|::.|::....||:|... |:...::|.|.|.|:|.|:||    .|.|.:.. .:
Zfish   126 NLHPKLIQLIVKVPPKIYDISSDITVNE-GSNVSLICAASGKPEPKISWR----HISPSARKYES 185

  Fly   182 RQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVE 246
            .:.|.:...||:|||..||.|.|.:..|....|.:.|.|.|.:. .......:.|..|.|.|...
Zfish   186 GEYLNITGISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAIH-EMKSHGVRPGQVALLRCEAA 249

  Fly   247 AAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVN--AVRHMLVVKSVRNADMGQYECRA 309
            |.|:...:|:               :.|.:.|......:|  :.|.:|.||::.....|.|.|.|
Zfish   250 AVPSPVFEWY---------------KGEKRINMGQGIVINNLSSRSVLTVKNMTQDRYGNYTCVA 299

  Fly   310 SNQISVKSGSVELTGRPMPCLFKINPGTQSSTS 342
            .|::...:.||.|  .|:     |.|.|.|:.|
Zfish   300 VNRLGTANASVPL--NPI-----IEPTTTSAVS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 21/94 (22%)
Ig strand B 52..56 CDD:409353 1/3 (33%)
Ig strand C 64..68 CDD:409353 1/6 (17%)
Ig strand E 94..98 CDD:409353 2/3 (67%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 26/86 (30%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 19/90 (21%)
FN3 339..431 CDD:238020 2/4 (50%)
negr1XP_009300786.1 Ig 42..121 CDD:472250 21/101 (21%)
Ig strand B 55..59 CDD:409353 1/3 (33%)
Ig strand C 67..71 CDD:409353 0/3 (0%)
Ig strand E 102..106 CDD:409353 2/3 (67%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig 140..222 CDD:472250 27/86 (31%)
Ig strand B 157..161 CDD:409256 0/3 (0%)
Ig strand C 170..174 CDD:409256 1/3 (33%)
Ig strand E 187..191 CDD:409256 1/3 (33%)
Ig strand F 201..206 CDD:409256 2/4 (50%)
Ig strand G 215..218 CDD:409256 0/2 (0%)
Ig 236..312 CDD:472250 21/90 (23%)
Ig strand B 242..246 CDD:409353 2/3 (67%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.