DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and DIP-gamma

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:320 Identity:93/320 - (29%)
Similarity:140/320 - (43%) Gaps:64/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPS--DLTEQRIGAIFEVVCEAQG 158
            |:::.::.||.|.|.|::|: |....|...|:||:.|.::.|.|  ||..|. |....:.|:|.|
  Fly   106 LKISKLRESDRGCYMCQINT-SPMK
KQVGCIDVQVPPDIINEESSADLAVQE-GEDATLTCKATG 168

  Fly   159 VPQPVITWRL-NGNVI---QPQS------NTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVA- 212
            .|||.:|||. :|.:|   :|.|      .:.|..||.|....|.|.|...|:|||.| .|||: 
  Fly   169 NPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDV-PPAVSK 232

  Fly   213 NVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQT 277
            .|.|.|.|:|.|..|..::.|.|||...|||.|||:|:....|..       ||.::...:.:.|
  Fly   233 RVSLSV
QFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLK-------GARTSNGFASVST 290

  Fly   278 ---------------------NRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVE 321
                                 ....|.|...:  :|||:|...:|:|.|.|.::|.:....|::.
  Fly   291 ASLESGSPGPEMLLDGPKYGITERRDGYRGVM--LLVVRSFSPSDVGTYHCVSTNSLGRAEGTLR 353

  Fly   322 LTGRPMPCLFKINPGTQSSTSHVLVWQTESLLPIMEFKLKFRQIPSNNVTRQVRTNWTEL 381
            |..      .|::||..:|....|.:            :...:..:.|..|..||.|..|
  Fly   354 LYE------IKLHPGASASNDDHLNY------------IGGLEEAARNAGRSNRTTWQPL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 7/21 (33%)
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 94..98 CDD:409353 1/1 (100%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 133..219 CDD:472250 36/98 (37%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 1/3 (33%)
Ig_3 222..311 CDD:464046 28/109 (26%)
FN3 339..431 CDD:238020 8/43 (19%)
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 8/23 (35%)
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 104..108 CDD:409353 1/1 (100%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 37/98 (38%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 1/4 (25%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 28/116 (24%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 2/10 (20%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.