DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr15

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:495 Identity:101/495 - (20%)
Similarity:158/495 - (31%) Gaps:159/495 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PTTVKTYENDTVQ------LPCT----LNTPFRYVRWHRDDVALV-------DSRHPEL--PPPD 86
            |.|:..|:....|      |||.    :..|..::|.....:..|       |.|...:  |.|:
  Fly   190 PPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE 254

  Fly    87 RIMLWPNGSLQVANVQSSDTGDYYCEMNSD--SGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAI 149
            |   |   |||:..||..|.|.|.|:::::  :..:|....:|    |:..:........:.|:.
  Fly   255 R---W---SLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVE----PKTELIGESTRHVKAGSQ 309

  Fly   150 FEVVC-EAQGVPQPV-ITWRLNGNVIQPQSNTGNRQSLILEIK---------------------- 190
            .::.| .:|.:..|: |.|..|    |.|....||:....||:                      
  Fly   310 VKLRCIISQALEPPLFINWFYN----QKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTA 370

  Fly   191 ---------------------------SRNQAGLI--------ECVASNGVGE-PAVANVYL--- 216
                                       |....||:        :.::.|.|.| .|.|.|.:   
  Fly   371 STTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATE 435

  Fly   217 ----HVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHS----TTHES 273
                .:|...|.:.......|..|..|.......|..||.:.....|...|..|.:    ||.::
  Fly   436 TSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDA 500

  Fly   274 ELQTNRSV--------DHYVNAV-RHMLVVKSVRNADMGQYECRASNQI---------------- 313
            |..|..:.        ..::..: ...|::.:|...|.|.|.|..||..                
  Fly   501 EAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLNGEYSAS 565

  Fly   314 SVKSGSVE---LTGRPMPCLFKINPGTQSSTSH-VLVWQTESLLPIMEFKLKF---RQIPSNNVT 371
            ::|||||.   |.|    |             | .|.|:..|.|..:.:.:||   |.|...|.|
  Fly   566 AIKSGSVSWSALIG----C-------------HGYLHWRNVSTLLTLLWIIKFALARDICQPNAT 613

  Fly   372 RQVRTNWTELTIPAQATNGLIYITTYTLHGLQPASLYEVS 411
            .:..|..:.|    :|.:|.....|........||.:.||
  Fly   614 SKATTRTSLL----RAGDGATADVTRETGPKSGASFHRVS 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 26/103 (25%)
IG_like 41..118 CDD:214653 25/97 (26%)
IG_like 145..218 CDD:214653 22/139 (16%)
Ig 147..219 CDD:299845 22/138 (16%)
I-set 224..323 CDD:254352 26/130 (20%)
IGc2 236..314 CDD:197706 20/106 (19%)
FN3 339..431 CDD:238020 20/77 (26%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/97 (24%)
V-set 204..290 CDD:284989 22/91 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.