DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr17

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:279 Identity:64/279 - (22%)
Similarity:101/279 - (36%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NTPFRYVRWHRD--DVALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYY--CEMNSDSGH 119
            |....|:..|||  |.|....|.             |.::.|.|:.:......|  |:::..|..
  Fly   384 NEQHSYLAAHRDGGDGAGSAVRR-------------NLTMPVLNITAQMGNHAYMPCQIHRLSDK 435

  Fly   120 VV------QQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSN 178
            .|      ..|.|.|.       |.:.:.::|..:|::        .....||.|....::|   
  Fly   436 PVSWVRMRDNHIISVD-------ETTFIADERFQSIYQ--------EDHDYTWSLQIKYVEP--- 482

  Fly   179 TGNRQSLILEIKSRNQAGLIECVASNGVGEPAV-ANVYLHVLFSPEVSIPQPVVYTKLGSRAHLE 242
                          :.||..||..:.   ||.: |.|:|.::......|.....:.|.||:..|.
  Fly   483 --------------SDAGWYECQMAT---EPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALH 530

  Fly   243 CIVEAA--PAATVKWFHHGLPVALGAHSTTHESELQTN--RSVDHYVNAVRHMLVVKSVRNADMG 303
            |||...  |...:.||.....::.....|...::|..|  .:|....|.: ..|::..||..|.|
  Fly   531 CIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTI-GSLIIPLVRKEDSG 594

  Fly   304 QYECRASNQISVKSGSVEL 322
            .|.|:.||.:||   ||:|
  Fly   595 NYTCQPSNSVSV---SVDL 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 13/62 (21%)
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 0/3 (0%)
Ig strand F 108..113 CDD:409353 2/6 (33%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 16/86 (19%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 1/3 (33%)
Ig_3 222..311 CDD:464046 23/92 (25%)
FN3 339..431 CDD:238020
dpr17NP_731670.1 V-set 415..507 CDD:462230 23/126 (18%)
IG_like 521..612 CDD:214653 29/94 (31%)
Ig strand B 527..531 CDD:409353 1/3 (33%)
Ig strand C 542..546 CDD:409353 0/3 (0%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.