DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr17

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:279 Identity:64/279 - (22%)
Similarity:101/279 - (36%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NTPFRYVRWHRD--DVALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYY--CEMNSDSGH 119
            |....|:..|||  |.|....|.             |.::.|.|:.:......|  |:::..|..
  Fly   384 NEQHSYLAAHRDGGDGAGSAVRR-------------NLTMPVLNITAQMGNHAYMPCQIHRLSDK 435

  Fly   120 VV------QQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSN 178
            .|      ..|.|.|.       |.:.:.::|..:|::        .....||.|....::|   
  Fly   436 PVSWVRMRDNHIISVD-------ETTFIADERFQSIYQ--------EDHDYTWSLQIKYVEP--- 482

  Fly   179 TGNRQSLILEIKSRNQAGLIECVASNGVGEPAV-ANVYLHVLFSPEVSIPQPVVYTKLGSRAHLE 242
                          :.||..||..:.   ||.: |.|:|.::......|.....:.|.||:..|.
  Fly   483 --------------SDAGWYECQMAT---EPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALH 530

  Fly   243 CIVEAA--PAATVKWFHHGLPVALGAHSTTHESELQTN--RSVDHYVNAVRHMLVVKSVRNADMG 303
            |||...  |...:.||.....::.....|...::|..|  .:|....|.: ..|::..||..|.|
  Fly   531 CIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTI-GSLIIPLVRKEDSG 594

  Fly   304 QYECRASNQISVKSGSVEL 322
            .|.|:.||.:||   ||:|
  Fly   595 NYTCQPSNSVSV---SVDL 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 15/74 (20%)
IG_like 41..118 CDD:214653 13/62 (21%)
IG_like 145..218 CDD:214653 15/73 (21%)
Ig 147..219 CDD:299845 14/72 (19%)
I-set 224..323 CDD:254352 30/103 (29%)
IGc2 236..314 CDD:197706 23/81 (28%)
FN3 339..431 CDD:238020
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 18/108 (17%)
Ig 415..507 CDD:299845 23/126 (18%)
IG_like 521..612 CDD:214653 29/94 (31%)
IGc2 524..605 CDD:197706 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.