DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Ama

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:359 Identity:88/359 - (24%)
Similarity:154/359 - (42%) Gaps:66/359 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MCSVVRCL-------LAALILGQVQAE--------LDFNNDLENSQKFKSIPTTVKTYENDTVQL 54
            :..::.||       |:|.::.|:..:        ::||..:|...:. |:....:..|:||..:
  Fly    15 LIGLIFCLAISLDSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQL-SVSWAKRPSESDTNSV 78

  Fly    55 PCTLNTPFRYVRWHRDDVALVDSRH----PELPPPDRIMLWPNGSLQVANVQSSDTGDYYCE-MN 114
            ..::          |:.::|.|.|:    .|.|.....:.    :.::.|::.||.|.|.|: :.
  Fly    79 VLSM----------RNILSLPDQRYNVTVTEGPKTGSAIY----TFRIQNIEVSDMGPYECQVLV 129

  Fly   115 SDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNT 179
            |.:..|.::.:::::..|.:.......|....|...|:.|.|.|.|:|.|:|....|.:.|... 
  Fly   130 SATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGG- 193

  Fly   180 GNRQSLI----LEIKS--RNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSR 238
                .|:    |.|:|  |...|...|:|.||.|:|....:.:.|.|.|::::.:|.:...:...
  Fly   194 ----HLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHS 254

  Fly   239 AHLECIVEAAPAATVKWFHHGLPVALGAHSTTHE-----SELQTNRSVDHYVNAVRHMLVVKSVR 298
            |.|||.|:..||.||.|..:|:|:....|   ||     |...|..||          |.:.||.
  Fly   255 AELECSVQGYPAPTVVWHKNGVPLQSSRH---HEVANTASSSGTTTSV----------LRIDSVG 306

  Fly   299 NADMGQYECRASNQISVKSGSVEL--TGRPMPCL 330
            ..|.|.|.|.|:|::......:.|  |..|:|.|
  Fly   307 EEDFGDYYCNATNKLGHADARLHLFQTVIPVPSL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 16/81 (20%)
Ig strand B 52..56 CDD:409353 0/3 (0%)
Ig strand C 64..68 CDD:409353 0/3 (0%)
Ig strand E 94..98 CDD:409353 0/3 (0%)
Ig strand F 108..113 CDD:409353 2/5 (40%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 24/91 (26%)
Ig strand B 150..154 CDD:409353 1/3 (33%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 1/7 (14%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 29/93 (31%)
FN3 339..431 CDD:238020
AmaNP_731114.2 I-set 33..143 CDD:400151 22/124 (18%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 1/4 (25%)
Ig strand E 101..112 CDD:409353 1/14 (7%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 21/78 (27%)
I-set 254..330 CDD:400151 28/88 (32%)
Ig strand B 255..259 CDD:409353 2/3 (67%)
Ig strand C 268..272 CDD:409353 2/3 (67%)
Ig strand E 298..302 CDD:409353 3/13 (23%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.