DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr16

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:288 Identity:74/288 - (25%)
Similarity:99/288 - (34%) Gaps:75/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDSG------HVVQQHAIEVQLAP 132
            |:..|...|||.:            |.||:.......|::|..||      .:..:|.|.|....
  Fly   195 LLPRRQLSLPPLN------------ATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTT 247

  Fly   133 QV-------LIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGN----VIQPQSNTGNRQSL- 185
            .:       |::.:.||....|.......      .||...   ||    .:......||..|| 
  Fly   248 FINDARFASLLQSTTLTTLVSGGALSTTA------TPVAAL---GNSFAHAVPGGQERGNSSSLS 303

  Fly   186 -ILEIKSRN--QAGLIECVASNGVGEPAV-ANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVE 246
             .|:||..|  .||..||..:.   ||.: |.|.|.|:......|.....:.|.|||..|.|||.
  Fly   304 WTLQIKYVNLEDAGWYECQLAT---EPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVR 365

  Fly   247 AAPAAT--VKWFHHGLPVALGAHSTTHESE---------LQTNR----SVDHYVNAVRHMLVVKS 296
            ....|.  :.|:.       |....|.|:|         .|.:|    |.:|..|.: ..||:..
  Fly   366 GTLEAPKYIFWYR-------GDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTI-GSLVIPL 422

  Fly   297 VRNADMGQYECR------ASNQISVKSG 318
            ||....|.|.|.      ||.|:.|.||
  Fly   423 VRKIHSGNYTCEPENSAAASMQLHVLSG 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 12/55 (22%)
IG_like 41..118 CDD:214653 10/43 (23%)
IG_like 145..218 CDD:214653 22/81 (27%)
Ig 147..219 CDD:299845 22/80 (28%)
I-set 224..323 CDD:254352 33/116 (28%)
IGc2 236..314 CDD:197706 28/98 (29%)
FN3 339..431 CDD:238020
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 36/155 (23%)
Ig <298..338 CDD:299845 16/42 (38%)
IG_like 352..447 CDD:214653 29/102 (28%)
Ig 358..439 CDD:143165 22/88 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.