DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Dscam2

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:514 Identity:128/514 - (24%)
Similarity:199/514 - (38%) Gaps:125/514 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IPTTVKTYENDTVQ-----------------LPCTLNTPFRYVRWHRDDVALVDSRHPELPPPDR 87
            :|..:..::.:.:|                 ||.|:|       |.:|...:..::|..:...|:
  Fly   610 VPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTIN-------WRKDGRPIDPTQHMSVKQVDQ 667

  Fly    88 IMLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEV 152
            .    |..|.:.|:.|..||:|.|.:.:.:..|....|:.|.:.|:.::||.|...:|...|. :
  Fly   668 Y----NSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIM-L 727

  Fly   153 VCEAQGVPQPVITWRLNGNVIQPQSNTGNRQ------------------SLILEIKSRNQAGLIE 199
            .|:|||||.|.|.|:         ..||::.                  ||:|:....::.|...
  Fly   728 HCQAQGVPTPSIVWK---------KATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYL 783

  Fly   200 CVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGL---- 260
            |.|:||:|......:.|.|..||..|.....|..|.|..|.|:|.|.......:.|...|.    
  Fly   784 CQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLN 848

  Fly   261 PVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGR 325
            |      ||.::..::...:.|    .|...|.:::|...|.|.|.|||||........|:|..:
  Fly   849 P------STNYKISVKQEATPD----GVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQ 903

  Fly   326 --PMPCLFKINPGTQSSTSHVLVWQTESL------LPIMEFKLKFRQIPSNNVTRQVRTNWTELT 382
              |:|... :.....||.|..:.||.::|      ..|:||:.....:|......|    |.::.
  Fly   904 EPPLPPSV-LEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQ----WQQIE 963

  Fly   383 I--PAQATNGLIYITTYTLHGLQPASLYEVSVLARNSFGWSDNSK--IVRF----ATGGEVEL-- 437
            :  |.. .|.:|       ..|:||:.|...|:|..|.|.|..|:  |||.    ..|..:.|  
  Fly   964 VKDPPH-FNAMI-------ENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSA 1020

  Fly   438 -PNYSTE---------SELQDDFTEEDFHNEITQRSEV---LSAS--MMFNSGSVNGRG 481
             |..|||         .||:        |.:| |...|   ||:|  ..:|..||:|.|
  Fly  1021 RPLSSTELLISWVAPLPELR--------HGDI-QGYNVGYKLSSSGNTAYNFTSVSGDG 1070

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 19/99 (19%)
IG_like 41..118 CDD:214653 18/93 (19%)
IG_like 145..218 CDD:214653 23/90 (26%)
Ig 147..219 CDD:299845 22/89 (25%)
I-set 224..323 CDD:254352 26/102 (25%)
IGc2 236..314 CDD:197706 22/81 (27%)
FN3 339..431 CDD:238020 28/105 (27%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 128/514 (25%)
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165 17/79 (22%)
IG_like 714..802 CDD:214653 25/97 (26%)
Ig 725..802 CDD:299845 22/86 (26%)
Ig 823..894 CDD:143165 21/80 (26%)
FN3 906..1006 CDD:238020 29/112 (26%)
FN3 1013..1111 CDD:238020 20/67 (30%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.