DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and ImpL2

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:353 Identity:65/353 - (18%)
Similarity:114/353 - (32%) Gaps:147/353 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTPHMCSVVRCLLA--ALILGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFR 63
            |..|:|::...|..  |.:.|:....:|.:||::||.:.:......:.:|.|.::...|      
  Fly     5 MNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKT------ 63

  Fly    64 YVRWHRDDVALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEV 128
                                ||.::                                        
  Fly    64 --------------------PPTKL---------------------------------------- 68

  Fly   129 QLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITW-----------RLNGNVIQPQSNTGNR 182
                          :|..||..|:|||..|...|.|.|           .|:.|.:..::     
  Fly    69 --------------QQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEA----- 114

  Fly   183 QSLILEIKSR-------NQAGLIECVASNGVGEPAVANVYLH----VLFSPEVSIP---QP-VVY 232
            .|.|:.::|.       ::|....||...| .:...|:..:|    ...:||.:.|   :| ::|
  Fly   115 PSAIVRVRSSHIIDHVLSEARTYTCVGRTG-SKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIY 178

  Fly   233 TK------LGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHM 291
            |:      :||...|.|.|.|.|.|.:.|.::                  .|:.:   |...||.
  Fly   179 TEKTHLDLMGSNIQLPCRVHARPRAEITWLNN------------------ENKEI---VQGHRHR 222

  Fly   292 ------LVVKSVRNADMGQYECRASNQI 313
                  |::..::..|||.|:|.|.|.:
  Fly   223 VLANGDLLISEIKWEDMGNYKCIARNVV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 5/82 (6%)
IG_like 41..118 CDD:214653 5/76 (7%)
IG_like 145..218 CDD:214653 21/94 (22%)
Ig 147..219 CDD:299845 21/93 (23%)
I-set 224..323 CDD:254352 25/106 (24%)
IGc2 236..314 CDD:197706 21/84 (25%)
FN3 339..431 CDD:238020
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/85 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.