DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr20

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:325 Identity:71/325 - (21%)
Similarity:109/325 - (33%) Gaps:92/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IPTTVKTYENDTVQLPCTLN----TPFRYVRWH-----RDDVALVDSRHPELPPPDRIMLWPNGS 95
            :|.||.|..:.   ||.:.|    ||....|..     |:....|||:||               
  Fly   185 VPATVATTSSG---LPSSSNASLATPTEPARNRSTGLVRNSAVKVDSKHP--------------- 231

  Fly    96 LQVANVQSSDTG------DYYCEMNSDSGHVVQ--QHAIEVQLAPQVLIEPSDLTEQRIGAIFEV 152
              ::..|.:|..      |.:...|....|..:  .|..:||...|.    ::||.| .|:...:
  Fly   232 --LSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQA----TNLTVQ-AGSSIHL 289

  Fly   153 VCEAQGVPQPVITW---------RLNGNVIQ-----PQSNTG------------NRQSLILEIKS 191
            .|....:....::|         :.|||.:.     ..:.||            |.:..|..:|.
  Fly   290 NCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKK 354

  Fly   192 RNQAGLIECVASNGVGEPAVANVYLH-----VLFSPEVSIPQPVVYTKLGSRAHLECIVE--AAP 249
            .::| :.||..|  ...|.|..:.||     |:...||..|....|.::.|...|.|:|.  |..
  Fly   355 DDEA-IYECQIS--THPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMT 416

  Fly   250 AATVKWFHH----GLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRAS 310
            ::.|.|.|.    ...|..|..|.  ::||..        :.....|.:..:...|.|.|.|..|
  Fly   417 SSVVFWKHMDNILNYDVTRGGVSV--KTELME--------DGANSTLSIAKISKTDSGNYTCSIS 471

  Fly   311  310
              Fly   472  471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 21/99 (21%)
IG_like 41..118 CDD:214653 20/91 (22%)
IG_like 145..218 CDD:214653 19/103 (18%)
Ig 147..219 CDD:299845 19/102 (19%)
I-set 224..323 CDD:254352 22/93 (24%)
IGc2 236..314 CDD:197706 19/81 (23%)
FN3 339..431 CDD:238020
dpr20NP_612066.1 IG_like 278..365 CDD:214653 17/88 (19%)
Ig 279..378 CDD:299845 21/102 (21%)
Ig 400..471 CDD:299845 18/80 (23%)
IG_like 402..480 CDD:214653 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.