Sequence 1: | NP_477404.1 | Gene: | wrapper / 37555 | FlyBaseID: | FBgn0025878 | Length: | 500 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_954545.1 | Gene: | Fgfrl1 / 360903 | RGDID: | 735156 | Length: | 529 | Species: | Rattus norvegicus |
Alignment Length: | 383 | Identity: | 78/383 - (20%) |
---|---|---|---|
Similarity: | 129/383 - (33%) | Gaps: | 92/383 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 TVQLPCTL-NTPFRYVRWHRDDVALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMN 114
Fly 115 SDSGHVV--------------------------QQHAIEVQLAPQVLIEPSDLTE----QRIGAI 149
Fly 150 FEVVCEAQGVPQPVITWRLNGNV---IQPQSNTGNRQSLILEIKSRNQAGLIECVASNGVGEPAV 211
Fly 212 -----ANVYLHVLFSPEVSIPQPVVYT-KLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTT 270
Fly 271 HESELQT----------NRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQI--SVKSG----- 318
Fly 319 ------------SVELTGRPMPCLFKINPGTQSSTSHVLVW--QTE-------SLLPI 355 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wrapper | NP_477404.1 | Ig | 41..124 | CDD:299845 | 19/99 (19%) |
IG_like | 41..118 | CDD:214653 | 17/67 (25%) | ||
IG_like | 145..218 | CDD:214653 | 17/80 (21%) | ||
Ig | 147..219 | CDD:299845 | 17/79 (22%) | ||
I-set | 224..323 | CDD:254352 | 24/128 (19%) | ||
IGc2 | 236..314 | CDD:197706 | 18/89 (20%) | ||
FN3 | 339..431 | CDD:238020 | 8/26 (31%) | ||
Fgfrl1 | NP_954545.1 | I-set | 29..112 | CDD:400151 | 18/77 (23%) |
Ig strand A' | 35..38 | CDD:409353 | |||
Ig strand B | 41..50 | CDD:409353 | 4/7 (57%) | ||
Ig strand C | 56..61 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 64..67 | CDD:409353 | 0/2 (0%) | ||
Ig strand D | 72..77 | CDD:409353 | 1/4 (25%) | ||
Ig strand E | 78..84 | CDD:409353 | 3/6 (50%) | ||
Ig strand F | 91..99 | CDD:409353 | 3/7 (43%) | ||
Ig strand G | 102..112 | CDD:409353 | 1/9 (11%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 117..152 | 5/34 (15%) | |||
IgI_2_FGFRL1-like | 143..234 | CDD:409442 | 18/92 (20%) | ||
Ig strand B | 164..168 | CDD:409442 | 0/3 (0%) | ||
Ig strand C | 177..181 | CDD:409442 | 1/3 (33%) | ||
Ig strand E | 200..204 | CDD:409442 | 1/3 (33%) | ||
Ig strand F | 214..219 | CDD:409442 | 1/4 (25%) | ||
Ig strand G | 227..230 | CDD:409442 | 0/2 (0%) | ||
Ig | 242..350 | CDD:416386 | 24/111 (22%) | ||
Ig strand A | 242..245 | CDD:409353 | 1/2 (50%) | ||
Ig strand A' | 249..253 | CDD:409353 | 2/3 (67%) | ||
Ig strand B | 261..268 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 272..279 | CDD:409353 | 1/6 (17%) | ||
Ig strand D | 304..309 | CDD:409353 | 0/4 (0%) | ||
Ig strand E | 317..322 | CDD:409353 | 2/8 (25%) | ||
Ig strand F | 330..338 | CDD:409353 | 3/7 (43%) | ||
Ig strand G | 341..349 | CDD:409353 | 2/7 (29%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 405..427 | 3/6 (50%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |