DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Sdk2

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:396 Identity:101/396 - (25%)
Similarity:158/396 - (39%) Gaps:65/396 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VQLPC-TLNTPFRYVRWHRDDVALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNS 115
            |.:|| ....|...:.|:: |.|||     |:....|.....:|.||::.:...|||...|..::
  Rat   329 VDIPCRAKGVPPPSITWYK-DAALV-----EVGKLTRFKQRSDGGLQISGLLPDDTGMVQCFAHN 387

  Fly   116 DSGHVVQQHAIEV-QLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWR------LNGNVI 173
            .:|.......:.| .:||.:...|.|.|... |....:.||..|.|:|.|||:      .:|:|.
  Rat   388 AAGEAQTSTYLAV
TSIAPNITRGPLDSTVID-GMSVVLACETSGAPRPAITWQKGERILASGSVQ 451

  Fly   174 QPQSNTGNRQSLILEIKSRNQAGLIECVASN--GVGEPAVANVYLHVLFSPEVSIP---QPVVYT 233
            .|:.......||::.....:.||...|:|:|  ||.|   |:..|.|.....::.|   |.|:  
  Rat   452 LPRFTLLESGSLLISPTHISDAGTYTCLATNSRGVDE---ASADLVV
WARTRITKPPQDQSVI-- 511

  Fly   234 KLGSRAHLECIVEAAPAATVK--WFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKS 296
             .|::|.:.|.|...|..||:  |...|..:|:   .|.....|..|.|           |.:..
  Rat   512 -KGTQASMVCGVTHDPRVTVRYVWEKDGATLAV---ETNPRIRLDRNGS-----------LHISQ 561

  Fly   297 VRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSH---VLVWQT--ESLLPIM 356
            ..:.|:|.|.||..:.....|.:..|..|.:|...:....|.|:...   .|.|..  :...|:|
  Rat   562 TWSGDIGTYTCRVLSAGGNDSRNAHLRV
RQLPHAPEHPVATLSTMERRAINLTWAKPFDGNSPLM 626

  Fly   357 EFKLKFRQIPSNNVTRQVRTNWTEL--TIPAQATNGLIYITTYTLHGLQPASLYEVSVLARNSFG 419
            .:.|   ::..||..      ||.|  ::..:||:.::       .||.||..|:..:.|.|..|
  Rat   627 RYIL---EMSENNAP------WTILLASVDPEATSVMV-------KGLVPARSYQFRLCAVNDVG 675

  Fly   420 WSDNSK 425
            ....||
  Rat   676 KGQFSK 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 19/72 (26%)
IG_like 41..118 CDD:214653 18/66 (27%)
IG_like 145..218 CDD:214653 24/80 (30%)
Ig 147..219 CDD:299845 24/79 (30%)
I-set 224..323 CDD:254352 24/103 (23%)
IGc2 236..314 CDD:197706 20/79 (25%)
FN3 339..431 CDD:238020 23/94 (24%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653
Ig 135..191 CDD:299845
IG_like 225..307 CDD:214653
IGc2 236..289 CDD:197706
I-set 311..400 CDD:254352 19/76 (25%)
Ig 329..397 CDD:143165 19/73 (26%)
I-set 405..495 CDD:254352 28/93 (30%)
Ig 419..495 CDD:299845 24/78 (31%)
Ig 505..589 CDD:299845 24/100 (24%)
IG_like 505..589 CDD:214653 24/100 (24%)
FN3 593..684 CDD:238020 25/105 (24%)
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.