DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and LRIT3

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:466 Identity:91/466 - (19%)
Similarity:158/466 - (33%) Gaps:140/466 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TVKTYENDTVQLPCTLNTPFRYVRWHRDDVALVDSRHPELP--PPDRIMLW------PNGSLQVA 99
            |:..:.|....:|   |...||::    ::|.:|.....|.  |||.:..|      |:|.|.::
Human   133 TLDLHNNKITSVP---NEALRYLK----NLAYLDLSSNRLTTLPPDFLESWTHLVSTPSGVLDLS 190

  Fly   100 N---VQSSDTGDYYCEMNSD----------------------------SGHVVQQHAIEVQLAPQ 133
            .   :.......::|:.:..                            :|.:.|:..:|..|.|.
Human   191 PSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTGILFQRAELEHCLKPS 255

  Fly   134 VLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWR------LNGNVIQPQSNTGNRQSLI-LEIKS 191
            |:...:.:. ..:|:...:.|:|.|.|.|.|||.      :|..|||.....|.|.|:: |...|
Human   256 VMTSATKIM-SALGSNVLLRCDATGFPTPQITWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGIS 319

  Fly   192 RNQAGLIECVASN--GVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVE-------- 246
            ...||..:|.|.|  |:.|..|....|.:..:|   || |....:.|.  |.|..|:        
Human   320 SKDAGDYKCKAKNLAGMSEAVVTVTVLGITTTP---IP-PDTSERTGD--HPEWDVQPGSGRSTS 378

  Fly   247 AAPAATVKWFHHGLPVALGAHSTT-------------HESELQTNRSVDHYVNAVRHMLVVKSVR 298
            .:.|::..|.....|.:..:.||.             ..|.:.:..::...::|...|...:|.:
Human   379 VSSASSYLWSSSFSPTSSFSASTLSPPSTASFSLSPFSSSTVSSTTTLSTSISASTTMANKRSFQ 443

  Fly   299 NADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSHV-LVWQT---------ESLL 353
            ....|:...:.:     |:||            |:.|.:.|....: |:.||         |:|.
Human   444 LHQGGKRNLKVA-----KNGS------------KLPPASTSKKEELALLDQTMLTETNAAIENLR 491

  Fly   354 PIMEFKLKFRQIPSNNVTRQVRTNWTELTIPAQATNGLIYITTY-----------------TLHG 401
            .:.|.|            ..|...|..:.....:...::| :.|                 |:.|
Human   492 VVSETK------------ESVTLTWNMINTTHNSAVTVLY-SKYGGKDLLLLNADSSKNQVTIDG 543

  Fly   402 LQPASLYEVSV 412
            |:|...|...|
Human   544 LEPGGQYMACV 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 19/119 (16%)
IG_like 41..118 CDD:214653 17/113 (15%)
IG_like 145..218 CDD:214653 27/81 (33%)
Ig 147..219 CDD:299845 27/80 (34%)
I-set 224..323 CDD:254352 20/119 (17%)
IGc2 236..314 CDD:197706 14/98 (14%)
FN3 339..431 CDD:238020 18/101 (18%)
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566
LRR 2 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3 104..128
LRR_8 105..165 CDD:290566 8/38 (21%)
LRR_4 105..146 CDD:289563 3/15 (20%)
leucine-rich repeat 107..130 CDD:275378
LRR 4 129..151 4/20 (20%)
LRR_4 131..170 CDD:289563 9/43 (21%)
leucine-rich repeat 131..154 CDD:275378 6/27 (22%)
LRR 5 152..175 6/26 (23%)
leucine-rich repeat 155..168 CDD:275378 3/12 (25%)
Ig 267..345 CDD:299845 26/77 (34%)
IG_like 267..345 CDD:214653 26/77 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 8/29 (28%)
FN3 486..550 CDD:214495 12/76 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.