DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr2

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:298 Identity:65/298 - (21%)
Similarity:112/298 - (37%) Gaps:68/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRYVRWHRDDVALVDSRHPE---LPPP------DR 87
            :|.....|.|:::   :||.|.: .::|..|.......||....:.:.||   .|||      .|
  Fly    54 DNLLPMVSAPSSI---DNDYVYI-ASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPR 114

  Fly    88 IMLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEV 152
            .:....|.....|.:..:.||       .|...:::..:.: |...:|...||   :|    |:|
  Fly   115 NITTRTGHTAAINCRVDNLGD-------KSVSWIRKRDLHI-LTAGILTYTSD---ER----FKV 164

  Fly   153 VCEAQGVPQPVITWRLNGNVIQPQSNTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVANVY-L 216
            |..|...     .|.|:....||:                 .:|:.||..:.   ||.::..: |
  Fly   165 VRTADSK-----DWTLHVKYAQPR-----------------DSGIYECQVNT---EPKISMAFRL 204

  Fly   217 HVLFSP---EVSIPQPV-VYTKLGSRAHLECIVEAAPAATVK-----WFHHGLPVALG---AHST 269
            :|:.:|   :..|..|. :|.|:||...|.|.|: .||.:.:     :::.| |..|.   ||..
  Fly   205 NVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVK-QPATSAQDIGPIYWYRG-PYILTPFVAHPN 267

  Fly   270 THESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYEC 307
            ....:||...........::..|.:.:.:..|.|.|.|
  Fly   268 DAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 18/85 (21%)
Ig strand B 52..56 CDD:409353 1/3 (33%)
Ig strand C 64..68 CDD:409353 0/3 (0%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 1/4 (25%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 18/86 (21%)
Ig strand B 150..154 CDD:409353 2/3 (67%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 24/98 (24%)
FN3 339..431 CDD:238020
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 25/132 (19%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 1/7 (14%)
CDR1 130..136 CDD:409355 2/12 (17%)
FR2 137..151 CDD:409355 2/14 (14%)
Ig strand C 137..143 CDD:409355 1/5 (20%)
Ig strand C' 149..153 CDD:409355 1/3 (33%)
CDR2 153..162 CDD:409355 4/15 (27%)
Ig strand D 162..167 CDD:409355 3/4 (75%)
FR3 163..192 CDD:409355 10/50 (20%)
Ig strand E 172..178 CDD:409355 2/5 (40%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 22/88 (25%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 2/4 (50%)
Ig strand G 310..313 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.