DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr3

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:388 Identity:62/388 - (15%)
Similarity:118/388 - (30%) Gaps:147/388 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MLWP--NG--SLQVANVQSSDTGD------YYCEMNSDS---------------------GHVVQ 122
            :|||  ||  :...:..|..|:||      :.....|.|                     .|..|
  Fly   122 LLWPFCNGLAAAAASTGQPDDSGDGPTLSTFLSSSQSQSPSPPAASASASSPSSFSSFAVAHGPQ 186

  Fly   123 QHAIEVQLAPQVLIEPS---------DLTEQRIGA---------------IFE------------ 151
            ..|..........::.|         |...:|.||               ||:            
  Fly   187 TEATNHTFKSLAFLDASFGSDLFAQTDAKRERSGAADEESQDADTSQSLPIFDFGMPRNITGRTG 251

  Fly   152 -----VVCEAQGVPQPVITW----RLNGNVIQPQSNTGNRQSLILEIKSRNQ------------A 195
                 :.|....:....::|    .|:...:...:.|.:::..:.|.|...:            :
  Fly   252 HTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDS 316

  Fly   196 GLIECVASNGVGEPAVANVY-LHVL-FSPE----VSIPQPVVYTKLGSRAHLECIVE---AAPAA 251
            |:.||..:.   ||.::..: |::: .||:    :|.| |.::.|.||...|.|:|:   .....
  Fly   317 GIYECQVNT---EPKMSMAFQLNIIEISPDAKAVISGP-PDLHFKAGSAIILNCLVQQPSVKDIG 377

  Fly   252 TVKWFH-------------------------HGLPVALGAHSTTHESELQ----TNRSVDHYV-N 286
            .:.|:.                         .|:|.....:....|.:||    |..:::..: :
  Fly   378 PIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGD 442

  Fly   287 AVRHMLVVKSVRNADMGQYECRASNQISV----------------KSGSVELTGRPMPCLFKI 333
            .::..|.:.:.:..|.|.|.|:.:...|.                |||:......|:..|..:
  Fly   443 TLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQKSGACPCALGPLQLLLHL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 11/59 (19%)
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 94..98 CDD:409353 1/5 (20%)
Ig strand F 108..113 CDD:409353 1/10 (10%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 133..219 CDD:472250 19/143 (13%)
Ig strand B 150..154 CDD:409353 1/20 (5%)
Ig strand C 163..167 CDD:409353 1/7 (14%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 22/125 (18%)
FN3 339..431 CDD:238020
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 11/88 (13%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 269..272 CDD:409353 0/2 (0%)
Ig strand E 304..308 CDD:409353 0/3 (0%)
Ig strand F 318..323 CDD:409353 2/4 (50%)
IG_like <441..477 CDD:214653 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.