DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr3

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:388 Identity:62/388 - (15%)
Similarity:118/388 - (30%) Gaps:147/388 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MLWP--NG--SLQVANVQSSDTGD------YYCEMNSDS---------------------GHVVQ 122
            :|||  ||  :...:..|..|:||      :.....|.|                     .|..|
  Fly   122 LLWPFCNGLAAAAASTGQPDDSGDGPTLSTFLSSSQSQSPSPPAASASASSPSSFSSFAVAHGPQ 186

  Fly   123 QHAIEVQLAPQVLIEPS---------DLTEQRIGA---------------IFE------------ 151
            ..|..........::.|         |...:|.||               ||:            
  Fly   187 TEATNHTFKSLAFLDASFGSDLFAQTDAKRERSGAADEESQDADTSQSLPIFDFGMPRNITGRTG 251

  Fly   152 -----VVCEAQGVPQPVITW----RLNGNVIQPQSNTGNRQSLILEIKSRNQ------------A 195
                 :.|....:....::|    .|:...:...:.|.:::..:.|.|...:            :
  Fly   252 HTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDS 316

  Fly   196 GLIECVASNGVGEPAVANVY-LHVL-FSPE----VSIPQPVVYTKLGSRAHLECIVE---AAPAA 251
            |:.||..:.   ||.::..: |::: .||:    :|.| |.::.|.||...|.|:|:   .....
  Fly   317 GIYECQVNT---EPKMSMAFQLNIIEISPDAKAVISGP-PDLHFKAGSAIILNCLVQQPSVKDIG 377

  Fly   252 TVKWFH-------------------------HGLPVALGAHSTTHESELQ----TNRSVDHYV-N 286
            .:.|:.                         .|:|.....:....|.:||    |..:::..: :
  Fly   378 PIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGD 442

  Fly   287 AVRHMLVVKSVRNADMGQYECRASNQISV----------------KSGSVELTGRPMPCLFKI 333
            .::..|.:.:.:..|.|.|.|:.:...|.                |||:......|:..|..:
  Fly   443 TLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQKSGACPCALGPLQLLLHL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 13/65 (20%)
IG_like 41..118 CDD:214653 11/59 (19%)
IG_like 145..218 CDD:214653 17/121 (14%)
Ig 147..219 CDD:299845 16/120 (13%)
I-set 224..323 CDD:254352 25/147 (17%)
IGc2 236..314 CDD:197706 17/110 (15%)
FN3 339..431 CDD:238020
dpr3NP_001014459.2 Ig 243..330 CDD:299845 11/89 (12%)
IG_like 243..329 CDD:214653 11/88 (13%)
Ig 350..464 CDD:299845 19/114 (17%)
IG_like <441..477 CDD:214653 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.