DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Opcml

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:357 Identity:87/357 - (24%)
Similarity:149/357 - (41%) Gaps:61/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IPTTV----------KTYENDTVQ------LPCTLNTPFRYVRW-HRDDVALVDSRHPELPPPDR 87
            :||.|          |..:|.||:      |.||::.....|.| :|..:....:....:.|  |
Mouse    25 VPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDP--R 87

  Fly    88 IMLWPNG----SLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGA 148
            :::..|.    |:.:.||...|.|.|.|.:.:|:.....:..:.||:.||::...||:|... |:
Mouse    88 VIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNE-GS 151

  Fly   149 IFEVVCEAQGVPQPVITWRLNGNVIQPQSNTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVAN 213
            ...::|.|.|.|:|.:||| :.:|.:.|......:.|.:....|:|:|..||.|.|.|..|.|..
Mouse   152 SVTLLCLAIGRPEPTVTWR-HLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRK 215

  Fly   214 VYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTN 278
            |.:.|.:.|.:|..:. ....:|.:..|.|...|.|.|..:||.....:|.|......|::.:.:
Mouse   216 VKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRIS 279

  Fly   279 RSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQ----- 338
                        .|...:|...|.|.|.|.|:|::...:.|:        .|::|:|.:.     
Mouse   280 ------------TLTFFNVSEKDYGNYTCVATNKLGNTNASI--------TLYEISPSSAVAGPG 324

  Fly   339 ------SSTSHVL--VWQTESLLPIMEFKLKF 362
                  :|.|..|  :|.:.:.  ...|.:||
Mouse   325 AVIDGVNSASRALACLWLSGTF--FAHFFIKF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 24/103 (23%)
IG_like 41..118 CDD:214653 24/97 (25%)
IG_like 145..218 CDD:214653 23/72 (32%)
Ig 147..219 CDD:299845 23/71 (32%)
I-set 224..323 CDD:254352 21/98 (21%)
IGc2 236..314 CDD:197706 19/77 (25%)
FN3 339..431 CDD:238020 7/26 (27%)
OpcmlXP_006510497.1 Ig 44..132 CDD:416386 20/89 (22%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 1/11 (9%)
Ig strand C' 72..76 CDD:409353 0/3 (0%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 10/35 (29%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 0/8 (0%)
FR4 125..132 CDD:409353 0/6 (0%)
Ig_3 135..206 CDD:404760 23/72 (32%)
Ig strand A 135..138 CDD:409353 1/2 (50%)
Ig strand A' 144..148 CDD:409353 2/3 (67%)
Ig strand B 151..160 CDD:409353 1/8 (13%)
Ig strand C 165..170 CDD:409353 2/4 (50%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig_3 223..300 CDD:404760 20/89 (22%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/15 (7%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.