DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Sdk1

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_808547.3 Gene:Sdk1 / 330222 MGIID:2444413 Length:2193 Species:Mus musculus


Alignment Length:416 Identity:96/416 - (23%)
Similarity:159/416 - (38%) Gaps:80/416 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DTVQLPC-TLNTPFRYVRWHRDDVALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEM 113
            :|:.:|| .:..|...::|::|.|.|...::|      |..:.|:|.|.:..:...|:|.:.|..
Mouse   384 ETMDIPCRAMGVPLPTLQWYKDAVPLSKLQNP------RYKVLPSGGLHIQKLSPEDSGIFQCFA 442

  Fly   114 NSDSGHVVQQHAIEV-QLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQS 177
            :::.|.|.....::| .:||.....|.|.|... |....:.||..|.|:|.|||: .||.|....
Mouse   443 SNEGGEVQTHTYLDV
TNIAPAFTQRPVDTTVTD-GMTAVLRCEVSGAPKPAITWK-RGNHILASG 505

  Fly   178 NTGNRQSLILEIKSR-------NQAGLIECVASN---GVGEPAVANVYLHVLFSPEVSIPQPVVY 232
            :....:.::||....       ..||...|.|:|   .|...|:..|:.....   |..|:..|.
Mouse   506 SVRIPRFMLLESGGLRIAPVFIQDAGNYTCYAANTEASVNASAMLTV
WNRTSI---VHPPEDRVV 567

  Fly   233 TKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSV 297
            .| |:.|.|.|.....|..::::......|.:.|.|:   |.:...:.         ..||:...
Mouse   568 IK-GTTATLCCGATHDPRTSLRYVWKKDNVVITASSS---SRIVVEKD---------GSLVISQT 619

  Fly   298 RNADMGQYECRASNQISVKSGS---------VELTGRPMPCLFKINPGTQSSTSHVLVWQTESLL 353
            .:.|:|.|.|    :|..:.||         :||...|...|..::|....|.:...|...:...
Mouse   620 WSGDIGDYTC----EIISEGGSDSRTARLEV
IELPHPPQNLLASLSPARSHSVTLSWVRPFDGNS 680

  Fly   354 PIMEFKLKFRQIPSNNVTRQVRTNWTELTIPAQATNGLIYITTYTLHGLQPASLYEVSVLARNSF 418
            |::.:.:   |:..||      :.|     ....:|....:|..|:.||.||..|:..|.|.|..
Mouse   681 PVLYYIV---QVSENN------SPW-----KVHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNQV 731

  Fly   419 GWSDNSKIVRFATGGEVELPNYSTES 444
            |..                 .||||:
Mouse   732 GKG-----------------QYSTET 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 18/74 (24%)
IG_like 41..118 CDD:214653 16/68 (24%)
IG_like 145..218 CDD:214653 22/82 (27%)
Ig 147..219 CDD:299845 22/81 (27%)
I-set 224..323 CDD:254352 23/107 (21%)
IGc2 236..314 CDD:197706 15/77 (19%)
FN3 339..431 CDD:238020 19/91 (21%)
Sdk1NP_808547.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Ig_2 94..169 CDD:290606
IG_like 100..169 CDD:214653
IG_like 183..263 CDD:214653
Ig 197..247 CDD:299845
IG_like 281..357 CDD:214653
IGc2 294..347 CDD:197706
I-set 368..457 CDD:254352 18/78 (23%)
Ig 388..454 CDD:143165 17/71 (24%)
I-set 462..552 CDD:254352 25/91 (27%)
Ig 476..552 CDD:299845 21/76 (28%)
I-set 557..646 CDD:254352 22/108 (20%)
Ig 562..646 CDD:299845 21/100 (21%)
FN3 650..741 CDD:238020 26/122 (21%)
fn3 753..839 CDD:278470
FN3 854..949 CDD:238020
FN3 954..1036 CDD:238020
FN3 1052..1148 CDD:238020
FN3 1158..1253 CDD:238020
FN3 1261..1349 CDD:238020
FN3 1360..1453 CDD:238020
FN3 1459..1554 CDD:238020
FN3 1562..1676 CDD:238020
FN3 1686..1779 CDD:238020
FN3 1784..1865 CDD:238020
FN3 1885..1978 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2057..2080
PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 2187..2193
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.