DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and CG6867

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:455 Identity:96/455 - (21%)
Similarity:164/455 - (36%) Gaps:139/455 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RDDVALVDSRHPELPPPDR-------------------------IMLW----PNGSLQVANVQSS 104
            :|.:::...:..:.||.:|                         |..|    ||||      .|:
  Fly   367 KDGLSITGPKGAQGPPGERGLKGIAGPRGRPGKPGTNGIPGVPGINAWKLQYPNGS------SSN 425

  Fly   105 DTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRI-----------GAIFEVVCEAQG 158
            |                            :||.|| :|:.::           |....:.|.|.|
  Fly   426 D----------------------------LLIPPS-ITDIQVPDFQRTVIVEEGRSLNLSCTATG 461

  Fly   159 VPQPVITWR------LNGNVIQPQSNTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLH 217
            .|.|.:.||      :|.|.::..|.:|  |.|.....:|:|.....|.|:||:...|.|...:.
  Fly   462 TPTPQVEWRREDGRTINVNGVEMASISG--QFLRFTNITRHQMAAYTCFANNGIAPVANATYLVE 524

  Fly   218 VLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESEL---QTNR 279
            |.|:|.:|:.:.::|.:..|.|.|||:|||.|.|...|            ...::.::   ....
  Fly   525 VQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIRYW------------ERAYDGKILDPSDKY 577

  Fly   280 SVDHYVNAVR--HMLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSSTS 342
            .::.|....:  ..|.:.::|..|.|.|.|.|.|:::....:.|:..:..      |..|....:
  Fly   578 GIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNATMVNFEIAPQDP------NSETPYVGN 636

  Fly   343 HVLVW---QTESLLPIMEFKLKFRQIPSNNVTR---QVRTNWTELTIPAQATNGLIYITTYTLHG 401
            ::.|:   ..||..|:.:      |.|..::.:   .:..|:     ..|||..|.|      .|
  Fly   637 NMKVYGQRPPESECPVCD------QCPDPSLYQCKDSILNNF-----EIQATGNLSY------PG 684

  Fly   402 L--QPASLYEVSVLARNSFGWSDNSKIVRFATGGEVELPNYSTESELQDDFTEEDFHN--EITQR 462
            |  :|.:.|..:|      |.....|:|....|..:..|:..::.|......|.|.:|  |.|.|
  Fly   685 LPKRPKTCYLYAV------GKPVFHKVVNEKFGSWLRDPSPDSDREKTFVTNENDPYNLFEFTTR 743

  Fly   463  462
              Fly   744  743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 12/83 (14%)
IG_like 41..118 CDD:214653 12/77 (16%)
IG_like 145..218 CDD:214653 22/89 (25%)
Ig 147..219 CDD:299845 22/77 (29%)
I-set 224..323 CDD:254352 23/103 (22%)
IGc2 236..314 CDD:197706 20/82 (24%)
FN3 339..431 CDD:238020 20/99 (20%)
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 22/84 (26%)
IGc2 449..511 CDD:197706 18/63 (29%)
IG_like 544..612 CDD:214653 19/79 (24%)
Ig 546..612 CDD:143165 18/77 (23%)
OLF 694..937 CDD:280371 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.