DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr18

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:414 Identity:79/414 - (19%)
Similarity:129/414 - (31%) Gaps:150/414 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVVRCLLAALILG-QVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRYVRWHRD 70
            |::|.|..||::| |||.               ...|:|:|                      :.
  Fly    31 SLLRLLTIALVIGSQVQV---------------LYTTSVET----------------------KS 58

  Fly    71 DVALVDSRHPELPPPDRIMLWPN-----GSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQL 130
            ..|...||:.|    :|.:|:.:     .:|..|:..|:.....|...:.|......|..||...
  Fly    59 PSASEQSRNGE----NRSLLFDDYNKTKSTLSTADYLSATRATLYAFSSQDQDEDHSQMPIEASN 119

  Fly   131 APQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNTGNRQ--SLILEIKSRN 193
            ||.                           .|:.|....|.:  |....|:.:  |..|.||:..
  Fly   120 APH---------------------------SPIPTKMSRGKI--PMETPGSMEFSSNSLPIKNVG 155

  Fly   194 QAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECI----VEAAPAATVK 254
            ....:..|..     |..|...|.|   ...::.||:..|:  :|.|....    |...|.:...
  Fly   156 TTDQLTTVTM-----PTTAFASLKV---DRSTMKQPIDSTR--TRNHWTASGFARVTERPRSKHH 210

  Fly   255 WFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMG-------QYECRASNQ 312
            ..||..|.        .|..:.:..|.|:.|:||.  |..::|.|..:|       .:..|.:.:
  Fly   211 HEHHWGPF--------FEEPINSATSGDNLVSAVH--LFTEAVLNCRVGMLKDKTVMWVRRTAEK 265

  Fly   313 ISVKS-GSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESLLPIMEFKLKFRQIPSNNVTRQVRT 376
            :|:.: |:|..:|.|                              ..::|| |.|:         
  Fly   266 VSLLTVGNVTYSGDP------------------------------RIRVKF-QYPN--------- 290

  Fly   377 NWTELTIPAQATNGLIYITTYTLH 400
            ||..|..|.|..:..:|:...:.|
  Fly   291 NWRLLINPTQTEDAGVYMCQVSTH 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 14/87 (16%)
IG_like 41..118 CDD:214653 14/81 (17%)
IG_like 145..218 CDD:214653 13/74 (18%)
Ig 147..219 CDD:299845 13/73 (18%)
I-set 224..323 CDD:254352 24/110 (22%)
IGc2 236..314 CDD:197706 18/88 (20%)
FN3 339..431 CDD:238020 11/62 (18%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 20/113 (18%)
Ig <258..326 CDD:299845 17/97 (18%)
IGc2 <417..461 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.