DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr8

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:236 Identity:52/236 - (22%)
Similarity:94/236 - (39%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 IGAIFEVVCEAQGVPQPVITWRLNGNV----IQPQSNTGNRQ------------SLILEIKSRNQ 194
            :|...::.|..:.:....::|..:.::    :...:.|.:::            :|.:....|..
  Fly    56 VGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKD 120

  Fly   195 AGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAA--PAATVKWFH 257
            :|:.||..|  ...|...:|||:::......|..|.::...||..:|.|||:.|  |..||.|.|
  Fly   121 SGIYECQIS--TT
PPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSH 183

  Fly   258 HGLPVAL-----GAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRAS--NQISV 315
            :...:..     |....|.:..|.|:|           :||.|:: ..|.|.|.|..|  |..||
  Fly   184 NREIINFDSPRGGISLVTEKGVLTTSR-----------LLVQKAI-TQDSGLYTCTPSNANPTSV 236

  Fly   316 KSGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESLLPIM 356
            :...|:  |.....:...|.|..:::      |...|||::
  Fly   237 RVHIVD--GEHPAAMHTGNNGNSTAS------QPPVLLPLV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 133..219 CDD:472250 14/88 (16%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 1/15 (7%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 27/97 (28%)
FN3 339..431 CDD:238020 4/18 (22%)
dpr8NP_727781.1 IG_like 51..131 CDD:214653 10/76 (13%)
Ig strand B 60..64 CDD:409353 0/3 (0%)
Ig strand C 73..77 CDD:409353 0/3 (0%)
Ig strand E 109..113 CDD:409353 1/3 (33%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 25/88 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.