DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr14

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:216 Identity:51/216 - (23%)
Similarity:84/216 - (38%) Gaps:41/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VKTYENDTVQLPCTLN-TPFRYVRWHR---DDVALV---------DSRHP-ELPPPDRIMLWPNG 94
            :.|..:.:|.|.|.:| ...:.|.|.|   ||:.|:         |||:. |...|:...|    
  Fly    84 ISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKL---- 144

  Fly    95 SLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQ---RIGAIFEVVCEA 156
            .:|.||  ..|.|.|.|:::|....|:..:...:....::|.|....|.:   :.|:..|:.|..
  Fly   145 LIQFAN--ERDEGPYECQVSSHPPLVLLVYLTI
IVPHVEILDERGSATPEKYYKAGSTIELQCVI 207

  Fly   157 QGVPQP--VITWRLNGNVIQPQSNTGN------------RQSLILEIKSRNQAGLIECVASNGVG 207
            ..:|.|  .||||....::...::.|.            ...|.:...:|...|...|:..|.:.
  Fly   208 SKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEIT 272

  Fly   208 EPAVANVYLHVLFSPEVSIPQ 228
            |    .|.:|||...|.:..|
  Fly   273 E----TVVVHV
LNGEEPAAMQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 25/87 (29%)
Ig strand B 52..56 CDD:409353 2/3 (67%)
Ig strand C 64..68 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 0/3 (0%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 21/102 (21%)
Ig strand B 150..154 CDD:409353 1/3 (33%)
Ig strand C 163..167 CDD:409353 2/3 (67%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 2/7 (29%)
FN3 339..431 CDD:238020
dpr14NP_572419.1 Ig 81..175 CDD:472250 26/96 (27%)
Ig strand B 92..96 CDD:409353 2/3 (67%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 1/7 (14%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 1/2 (50%)
IG_like 191..279 CDD:214653 17/91 (19%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 2/5 (40%)
Ig strand E 248..252 CDD:409473 1/3 (33%)
Ig strand F 262..267 CDD:409473 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.