DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Kirrel1

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:569 Identity:112/569 - (19%)
Similarity:178/569 - (31%) Gaps:225/569 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PHMCSVVRCLL---AALILGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRY 64
            ||:  ||..|:   .||.|...|.            :|...|............|||.|......
  Rat    32 PHL--VVAYLIFVTLALALPGTQT------------RFSQEPADQTVVAGHRAVLPCVLLNYSGI 82

  Fly    65 VRWHRDDVALVDSRHPELPPPDRIMLWPN----GS-------LQVANVQSSDTGDYYCEMNS--- 115
            |:|.:|.:||...:        .:..||.    ||       |::.:.:.||...|.|:...   
  Rat    83 VQWTKDGLALGMGQ--------GLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL 139

  Fly   116 ------------------DSGHVV-------------------------------QQHAI----- 126
                              |.|.|:                               |:.|:     
  Rat   140 RSRRAKLTVLIPPEDTRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTEL 204

  Fly   127 ------EVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQ-------------PVITWRLNGNV 172
                  |..:: |:||:|:||.   ||.:|......:.:|.             |.:|..     
  Rat   205 LKDGKRETTIS-QLLIQPTDLD---IGRVFTCRSMNEAIPNGKETSIELDVHHPPTVTLS----- 260

  Fly   173 IQPQS------------NTGNRQSL---------ILE--IKSRNQAGL--------IECVASNGV 206
            |:||:            .|.|.:.|         ::|  .:||.:..:        :.|...|.|
  Rat   261 IEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKV 325

  Fly   207 GEPAVANVYLHVLFSPEVSI-PQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTT 270
            |...|:.: ::|.|:|.:.: |:|.. |.:||...|.|:....|..|:.|             |.
  Rat   326 GSTNVSTL-VNVHFAPRIVVYPKPTT-TDIGSDVTLTCVWVGNPPLTLTW-------------TK 375

  Fly   271 HESEL---------QTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRA-SNQISVKSGSVEL--- 322
            .:|.:         :.|.|.....|:  :.|::|||..||.|.|.||| ..:|.|....|.|   
  Rat   376 KDSNMGPRLPGSPPEANLSAQVLSNS--NQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVN 438

  Fly   323 ----------------TGRPMPCLFKINPGTQSSTSHVLVWQTESLLPIMEFKLKFRQIPSNNVT 371
                            .|..:.|.....|....     :.|         .:|..|.::.:....
  Rat   439 GPPIISSEAVQFAVRGDGGKVECFIGSTPPPDR-----IAW---------AWKENFLEVGTLERY 489

  Fly   372 RQVRTNWTELTIPAQATNGLIYITTYTLHGLQPASLY-EVSVLARNSFG 419
            ...|||           :|...::|.|::.:..|... ..:..|.||||
  Rat   490 TVERTN-----------SGSGVLSTLTINNVMEADFQTHYNCTAWNSFG 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 23/145 (16%)
IG_like 41..118 CDD:214653 20/108 (19%)
IG_like 145..218 CDD:214653 20/116 (17%)
Ig 147..219 CDD:299845 19/115 (17%)
I-set 224..323 CDD:254352 30/128 (23%)
IGc2 236..314 CDD:197706 23/87 (26%)
FN3 339..431 CDD:238020 15/82 (18%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 20/101 (20%)
Ig 57..148 CDD:299845 19/98 (19%)
Ig2_KIRREL3-like 170..251 CDD:143236 13/84 (15%)
I-set 255..336 CDD:254352 16/86 (19%)
Ig_2 259..337 CDD:290606 14/83 (17%)
Ig_2 340..437 CDD:290606 31/112 (28%)
IG_like 346..437 CDD:214653 30/106 (28%)
Ig5_KIRREL3 439..536 CDD:143306 18/114 (16%)
IG_like 451..536 CDD:214653 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.