DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and NEGR1

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:232 Identity:63/232 - (27%)
Similarity:99/232 - (42%) Gaps:25/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGV 159
            |||:.||..:|.|.|.|.:.:.......|..:.||:.|::....:|:|... |....:.|.|.|.
Human   102 SLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNE-GTNVTLTCLATGK 165

  Fly   160 PQPVITWRLNGNVIQPQSNT-GNRQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPE 223
            |:|.|:||    .|.|.:.. .|.|.|.:...:|:|||..||.|.|.|..|.|..|.:.|.|:|.
Human   166 PEPSISWR----HISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPT 226

  Fly   224 VSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESEL---QTNRSVDHYV 285
            :...:....|. |....:.|.....|....:|:             ..|.:|   |....:.:: 
Human   227 IQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWY-------------KGEKKLFNGQQGIIIQNF- 276

  Fly   286 NAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVEL 322
             :.|.:|.|.:|.....|.|.|.|:|::...:.|:.|
Human   277 -STRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 9/22 (41%)
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 94..98 CDD:409353 2/2 (100%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 133..219 CDD:472250 28/86 (33%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 1/2 (50%)
Ig_3 222..311 CDD:464046 17/91 (19%)
FN3 339..431 CDD:238020
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 10/32 (31%)
Ig strand B 56..60 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 101..105 CDD:409353 2/2 (100%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 24/73 (33%)
IG_like 231..312 CDD:214653 18/96 (19%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 254..258 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.