Sequence 1: | NP_477404.1 | Gene: | wrapper / 37555 | FlyBaseID: | FBgn0025878 | Length: | 500 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766486.1 | Gene: | Kirrel2 / 243911 | MGIID: | 2442334 | Length: | 700 | Species: | Mus musculus |
Alignment Length: | 394 | Identity: | 91/394 - (23%) |
---|---|---|---|
Similarity: | 145/394 - (36%) | Gaps: | 76/394 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 FNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRYVRWHRDDVALVDSRHPELPPPDRIMLW 91
Fly 92 PNGS-------LQVANVQSSDTGDYYCEMNSDSG---HVVQQHAIEVQLAPQVLIEPSDLTEQRI 146
Fly 147 GAIFEVVCEAQG--VPQPVITW-----RLNGN-----VIQPQSNTGNRQSLILEIKSRNQAGLIE 199
Fly 200 CVA-SNGVGEPAVANVYLHVLFSPEVSI---PQPVVYTKLGSRAHLECIVEAAPAAT-VKWFHHG 259
Fly 260 LPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQI--SVKSGSVEL 322
Fly 323 TGRPM----PCLFKINPGTQSSTSHVLVWQTESLLPIMEFKLKFRQIPSNNVTRQVRTNWTELTI 383
Fly 384 PAQA 387 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wrapper | NP_477404.1 | Ig | 41..124 | CDD:299845 | 24/92 (26%) |
IG_like | 41..118 | CDD:214653 | 22/83 (27%) | ||
IG_like | 145..218 | CDD:214653 | 17/85 (20%) | ||
Ig | 147..219 | CDD:299845 | 17/84 (20%) | ||
I-set | 224..323 | CDD:254352 | 23/104 (22%) | ||
IGc2 | 236..314 | CDD:197706 | 17/80 (21%) | ||
FN3 | 339..431 | CDD:238020 | 12/49 (24%) | ||
Kirrel2 | NP_766486.1 | IG | 27..116 | CDD:214652 | 24/93 (26%) |
Ig | 122..220 | CDD:416386 | 24/99 (24%) | ||
Ig strand A | 123..126 | CDD:409353 | 2/2 (100%) | ||
Ig strand A' | 129..133 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 140..147 | CDD:409353 | 1/6 (17%) | ||
Cell attachment site. /evidence=ECO:0000255 | 146..148 | 0/1 (0%) | |||
Ig strand C | 153..158 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 161..163 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 166..173 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 180..188 | CDD:409353 | 1/7 (14%) | ||
Ig strand F | 197..205 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 211..217 | CDD:409353 | 0/5 (0%) | ||
Ig_3 | 223..292 | CDD:404760 | 20/93 (22%) | ||
Ig strand B | 241..245 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 272..275 | CDD:409353 | 1/2 (50%) | ||
Ig strand F | 281..290 | CDD:409353 | 2/25 (8%) | ||
Ig strand G | 298..301 | CDD:409353 | 0/2 (0%) | ||
Ig | 315..392 | CDD:416386 | 14/60 (23%) | ||
Ig strand A' | 316..321 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 324..333 | CDD:409353 | 3/10 (30%) | ||
Ig strand C | 339..343 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 346..348 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 351..354 | CDD:409353 | 1/2 (50%) | ||
Ig strand E | 355..360 | CDD:409353 | 2/13 (15%) | ||
Ig strand F | 368..376 | CDD:409353 | |||
Ig strand G | 382..392 | CDD:409353 | |||
Ig | 394..498 | CDD:416386 | |||
Ig strand A | 395..399 | CDD:409353 | |||
Ig strand A' | 401..404 | CDD:409353 | |||
Ig strand B | 412..419 | CDD:409353 | |||
Ig strand C | 426..431 | CDD:409353 | |||
Ig strand C' | 433..436 | CDD:409353 | |||
Ig strand D | 444..451 | CDD:409353 | |||
Ig strand E | 461..468 | CDD:409353 | |||
Ig strand F | 479..486 | CDD:409353 | |||
Ig strand G | 489..496 | CDD:409353 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 542..576 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 671..700 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |