DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Ntm

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:400 Identity:99/400 - (24%)
Similarity:160/400 - (40%) Gaps:102/400 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAALILGQVQAELDFNNDLENSQKFKSIP------TTVKTYENDTVQ------LPCTLNTPFRYV 65
            ||||.|                  |:.:|      |..|..:|.||:      |.||::.....|
Mouse    20 LAALCL------------------FQGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRV 66

  Fly    66 RW-HRDDVALVDSRHPELPPPDRIMLWPNG----SLQVANVQSSDTGDYYCEMNSDSGHVVQQHA 125
            .| :|..:....:....|.|  |::|..|.    |:::.||...|.|.|.|.:.:|:.....:..
Mouse    67 AWLNRSTILYAGNDKWCLDP--RVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVH 129

  Fly   126 IEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNTGNRQSLILEIK 190
            :.||::|:::...||::... |....:.|.|.|.|:|.:|||    .|.|::.....:...|||:
Mouse   130 LIVQVSPKIVEISSDISINE-GNNISLTCIATGRPEPTVTWR----HISPKAVGFVSEDEYLEIQ 189

  Fly   191 --SRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVS------IPQPVVYTKLGSRAHLECIVEA 247
              :|.|:|..||.|||.|..|.|..|.:.|.:.|.:|      :|       :|.:..|:|...|
Mouse   190 GITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVP-------VGQKGTLQCEASA 247

  Fly   248 APAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQ 312
            .|:|..:||.....:..|......|:....::..  :.|...|          |.|.|.|.|||:
Mouse   248 VPSAEFQWFKDDKRLVEGKKGVKVENRPFLSKLT--FFNVSEH----------DYGNYTCVASNK 300

  Fly   313 ISVKSGSVELTGRPMPCLFKINPGTQSS------TSHVLVWQTES-----------------LLP 354
            :...:.|:        .||::|..|.|:      |:.:..|:...                 |||
Mouse   301 LGHTNASI--------MLFELNEPTSSTLLQEVKTTALTPWKGPGAVSEVNNGTSRRAGCIWLLP 357

  Fly   355 --IMEFKLKF 362
              ::...|||
Mouse   358 LLVLHLLLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 25/99 (25%)
IG_like 41..118 CDD:214653 25/93 (27%)
IG_like 145..218 CDD:214653 26/74 (35%)
Ig 147..219 CDD:299845 26/73 (36%)
I-set 224..323 CDD:254352 22/104 (21%)
IGc2 236..314 CDD:197706 19/77 (25%)
FN3 339..431 CDD:238020 8/48 (17%)
NtmNP_001344522.1 Ig 44..132 CDD:416386 22/89 (25%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 1/11 (9%)
Ig strand C' 72..76 CDD:409353 0/3 (0%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 12/35 (34%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 0/8 (0%)
FR4 125..132 CDD:409353 0/6 (0%)
Ig_3 136..205 CDD:404760 23/73 (32%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 1/8 (13%)
Ig strand F 197..205 CDD:409353 4/7 (57%)
Ig_3 222..299 CDD:404760 20/95 (21%)
putative Ig strand A 223..229 CDD:409353 2/5 (40%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 0/5 (0%)
Ig strand F 292..297 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.