DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and IGSF9B

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:541 Identity:113/541 - (20%)
Similarity:192/541 - (35%) Gaps:158/541 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AALILGQVQAE-----------LDFNNDLENSQKF------------KSIPTTVKTYENDTVQLP 55
            |:|.|.||::|           ||...|..::..:            ::.|..::..|..::.:.
Human    96 ASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSITMT 160

  Fly    56 CT-LNTPFRYVRWHRDDVALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDSGH 119
            || ...|...|.|.::...|..|...::         .:|||.|.:|...|.|.|.|...|..|.
Human   161 CTAFGNPKPIVTWLKEGTLLGASGKYQV---------SDGSLTVTSVSREDRGAYTCRAYSIQGE 216

  Fly   120 VVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVP-QPVITWRLNGNVIQPQSNTGNRQ 183
            .|....:.||..|.::..|.::| ..|.....:.|.|:..| ....||......:..|::...|.
Human   217 AVHTTHLLVQGPPFIVSPPENIT-VNISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRV 280

  Fly   184 SLILE-------IKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHL 241
            .::::       :|..: :|...||.||.:|....|:.||.|.:...|....||:|..:|...::
Human   281 RILIDGTLIIFRVKPED-SGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYI 344

  Fly   242 ECIVEAAPAAT-VKWFHHGLPV------------------------ALGAHSTTHESELQT---- 277
            .|.|:|.|.|| |||...|.|:                        |||.::....:.|.|    
Human   345 RCPVDAEPPATVVKWNKDGRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTMGQS 409

  Fly   278 --NRSV-------------DHYVNAVRHMLV---------------------------------- 293
              .|.|             ::...|.|.:|:                                  
Human   410 APARLVLKDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHSALPSGSLQ 474

  Fly   294 VKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSS-------TSHVLVWQT-- 349
            .:::...|.|::||.|:|.::..:.|..||      :...:|....|       |:..:.|:.  
Human   475 FRALSKEDHGEWECVATNVVTSITASTHLT------VIGTSPHAPGSVRVQVSMTTANVSWEPGY 533

  Fly   350 ----ESLLPIMEFKLKFRQIPSNNVTRQVRTNWTELTIPAQATNGLIYITTYTLHGLQPASLYEV 410
                |....:...:.:|..           .:|..|.:|.    |..::...|   |:|.:.|:.
Human   534 DGGYEQTFSVWMKRAQFGP-----------HDWLSLPVPP----GPSWLLVDT---LEPETAYQF 580

  Fly   411 SVLARNSFGWSDNSKIVRFAT 431
            ||||:|..|.|..|::|...|
Human   581 SVLAQNKLGTSAFSEVVTVNT 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 21/83 (25%)
IG_like 41..118 CDD:214653 19/77 (25%)
IG_like 145..218 CDD:214653 18/80 (23%)
Ig 147..219 CDD:299845 17/79 (22%)
I-set 224..323 CDD:254352 33/176 (19%)
IGc2 236..314 CDD:197706 28/155 (18%)
FN3 339..431 CDD:238020 22/104 (21%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 6/18 (33%)
Ig 41..115 CDD:143165 6/18 (33%)
I-set 139..225 CDD:254352 21/94 (22%)
IGc2 153..210 CDD:197706 17/65 (26%)
I-set 229..321 CDD:254352 21/93 (23%)
Ig 235..321 CDD:299845 20/87 (23%)
IG_like 331..414 CDD:214653 20/82 (24%)
Ig <353..414 CDD:299845 12/60 (20%)
IG_like 426..505 CDD:214653 12/84 (14%)
Ig 442..505 CDD:299845 9/68 (13%)
FN3 510..601 CDD:238020 23/108 (21%)
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.