DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Iglon5

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:340 Identity:85/340 - (25%)
Similarity:135/340 - (39%) Gaps:54/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAALILGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRYVRW-HRDDVALVD 76
            ||.:..|.:...|:|::..:|          ....|.|...|.|.::.....|.| :|.::....
Mouse    21 LAVISRGLLSQSLEFSSPADN----------YTVCEGDNATLSCFIDEHVTRVAWLNRSNILYAG 75

  Fly    77 SRHPELPPPDRIML-WPNG-SLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQL---APQVLI 136
            :......|..|::: .|.. |:.:..|...|.|.|.|...:..    |.:..:|.|   .|..::
Mouse    76 NDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSFQTRH----QPYTTQVYLIVHVPARIV 136

  Fly   137 EPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNTG-NRQSLILEIK--SRNQAGLI 198
            ..|.......|....::|.|.|.|:|.:|||        |...| ..:..||||.  .|.|||..
Mouse   137 NISSPVAVNEGGNVNLLCLAVGRPEPTVTWR--------QLRDGFTSEGEILEISDIQRGQAGEY 193

  Fly   199 ECVASNGVGE-PAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPV 262
            |||..|||.. |....|.:.|.:.|.:: ......|.||..|.|.|...|.|.|..:|:.....:
Mouse   194 ECVTHNGVNSAPDSRRVLVTVNYPPTIT-DVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLL 257

  Fly   263 ALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPM 327
            :.|   :....::||.|:        |.||:..:|.....|.|.|||:|::...|.|:.|     
Mouse   258 SSG---SAEGLKVQTERT--------RSMLLFANVSARHYGNYTCRAANRLGASSASMRL----- 306

  Fly   328 PCLFKINPGTQSSTS 342
                 :.||:..:::
Mouse   307 -----LRPGSLENSA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 17/85 (20%)
IG_like 41..118 CDD:214653 16/79 (20%)
IG_like 145..218 CDD:214653 27/76 (36%)
Ig 147..219 CDD:299845 27/75 (36%)
I-set 224..323 CDD:254352 26/98 (27%)
IGc2 236..314 CDD:197706 22/77 (29%)
FN3 339..431 CDD:238020 0/4 (0%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 20/101 (20%)
Ig strand A' 41..46 CDD:409353 1/14 (7%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 2/6 (33%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 0/9 (0%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 9/34 (26%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 0/7 (0%)
Ig strand G 120..129 CDD:409353 2/8 (25%)
FR4 122..129 CDD:409353 2/6 (33%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 23/72 (32%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 1/8 (13%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 3/4 (75%)
Ig strand F 191..199 CDD:409353 4/7 (57%)
Ig_3 217..295 CDD:404760 24/89 (27%)
putative Ig strand A 218..224 CDD:409353 1/6 (17%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.