DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and zig-3

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:256 Identity:53/256 - (20%)
Similarity:86/256 - (33%) Gaps:95/256 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNTG 180
            ||.|:..:.::::       ||..:......|....:.|:....|..||.|..:|..||     |
 Worm    34 DSTHLTTKPSLKI-------IEGLEDNTVSTGESVTLRCDVLSTPTGVIYWEKDGQRIQ-----G 86

  Fly   181 NRQSLILEIKSRN------QAGLI-----------------ECVASNGVGEPAVANVYLH--VLF 220
            :::..:.| |..|      ::|:|                 :|||:||           |  |..
 Worm    87 DKELNVFE-KVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNG-----------HDTVES 139

  Fly   221 SPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTN------- 278
            |.::|:....|..|...|        :||..|:              ||....|||.|       
 Worm   140 SAKISVEGQTVKCKSTRR--------SAPVITM--------------STESRFELQDNAATLICR 182

  Fly   279 -------------RSVD----HYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVEL 322
                         :.:|    .|.......|:::.::.:|||.|.|.|.|:.....|...|
 Worm   183 ADRRANWNWMFEDKKIDFDSGRYELLPSGDLLIRKIQWSDMGSYFCIAHNKYGESRGETFL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 3/7 (43%)
IG_like 41..118 CDD:214653 1/1 (100%)
IG_like 145..218 CDD:214653 21/97 (22%)
Ig 147..219 CDD:299845 21/96 (22%)
I-set 224..323 CDD:254352 25/123 (20%)
IGc2 236..314 CDD:197706 20/101 (20%)
FN3 339..431 CDD:238020
zig-3NP_509336.1 I-set 45..145 CDD:254352 25/123 (20%)
Ig 61..142 CDD:143165 22/97 (23%)
IG_like 177..244 CDD:214653 12/67 (18%)
Ig <191..237 CDD:299845 10/45 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.