DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and zig-2

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:213 Identity:52/213 - (24%)
Similarity:78/213 - (36%) Gaps:69/213 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNG---------NVIQPQSNTGNRQSLILEIKS-- 191
            |:| :....|..|.:.|.|.|.|.|.|.|.|||         ||.:...|.|.:.|....:.|  
 Worm    39 PND-SNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGKQVSNAAMVSSHY 102

  Fly   192 -------RNQAGLIECVASNGVGE-PAVANVY-------------------LHVLFSPEVSIPQP 229
                   || :|..:|:..||:.: ..||.|:                   :.|.|..|:|    
 Worm   103 RIPCATARN-SGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMTVDFRLEIS---- 162

  Fly   230 VVYTKLGSRAHLECIVEAAPAATVKW-FHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLV 293
                  .:...|.|..|.|    .:| :|.|             .:|.||.. :.|.......|:
 Worm   163 ------NNAVALSCRSETA----TEWSWHKG-------------EQLLTNDG-ERYQMFPSGDLI 203

  Fly   294 VKSVRNADMGQYECRASN 311
            ::::..:|||:|.|.|.|
 Worm   204 IRNISWSDMGEYNCTARN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845
IG_like 41..118 CDD:214653
IG_like 145..218 CDD:214653 27/110 (25%)
Ig 147..219 CDD:299845 27/109 (25%)
I-set 224..323 CDD:254352 20/89 (22%)
IGc2 236..314 CDD:197706 19/77 (25%)
FN3 339..431 CDD:238020
zig-2NP_510069.1 I-set 34..134 CDD:254352 29/96 (30%)
Ig 34..121 CDD:299845 24/83 (29%)
Ig <179..232 CDD:299845 14/57 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.