Sequence 1: | NP_477404.1 | Gene: | wrapper / 37555 | FlyBaseID: | FBgn0025878 | Length: | 500 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509335.1 | Gene: | zig-4 / 181051 | WormBaseID: | WBGene00006981 | Length: | 253 | Species: | Caenorhabditis elegans |
Alignment Length: | 237 | Identity: | 51/237 - (21%) |
---|---|---|---|
Similarity: | 79/237 - (33%) | Gaps: | 71/237 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 QQHAIEVQLAPQV----LIEPSDL-----TEQRI---GAIFEVVCEAQGVPQPVITWRLNGNVIQ 174
Fly 175 PQSNTGNRQSLI-----------------LEIKSRNQAGLIECVASNG------------VGEPA 210
Fly 211 VANVYLHVLFSPEVSIPQPVVYT-----KLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTT 270
Fly 271 HESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQ 312 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wrapper | NP_477404.1 | Ig | 41..124 | CDD:299845 | 0/1 (0%) |
IG_like | 41..118 | CDD:214653 | |||
IG_like | 145..218 | CDD:214653 | 18/104 (17%) | ||
Ig | 147..219 | CDD:299845 | 18/100 (18%) | ||
I-set | 224..323 | CDD:254352 | 25/94 (27%) | ||
IGc2 | 236..314 | CDD:197706 | 21/77 (27%) | ||
FN3 | 339..431 | CDD:238020 | |||
zig-4 | NP_509335.1 | I-set | 47..147 | CDD:254352 | 17/99 (17%) |
Ig | 65..144 | CDD:143165 | 15/78 (19%) | ||
IG_like | 176..245 | CDD:214653 | 21/77 (27%) | ||
Ig | <193..238 | CDD:299845 | 16/58 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |