DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and zig-4

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:237 Identity:51/237 - (21%)
Similarity:79/237 - (33%) Gaps:71/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QQHAIEVQLAPQV----LIEPSDL-----TEQRI---GAIFEVVCEAQGVPQPVITWRLNGNVIQ 174
            :.|:..|.||.::    |..|:.:     .|..:   |..:::.|:....|...|.|:.||.:||
 Worm    23 EMHSAVVTLANEIDTNYLTSPAKIKIVAPLESALIPGGETYQLRCDIMSTPAATIHWKFNGKLIQ 87

  Fly   175 PQSNTGNRQSLI-----------------LEIKSRNQAGLIECVASNG------------VGEPA 210
            ..:.....:.|:                 ::..|...:|...||..||            .||.:
 Worm    88 GSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNGHQTIETVAEVEIEGEAS 152

  Fly   211 VANVYLHVLFSPEVSIPQPVVYT-----KLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTT 270
            ...       |...|.|:.|.:|     ..|:.|.|.|  .|.......|..:            
 Worm   153 GCR-------SNHKSAPEIVFWTDSRFEMTGNVATLVC--RANQQVDWVWMSN------------ 196

  Fly   271 HESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQ 312
              .||..|.  |.:.......||:|::...|||.|.|.|.||
 Worm   197 --DELVKNN--DKFTVLSNGDLVIKNIVWDDMGTYTCIARNQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 0/1 (0%)
IG_like 41..118 CDD:214653
IG_like 145..218 CDD:214653 18/104 (17%)
Ig 147..219 CDD:299845 18/100 (18%)
I-set 224..323 CDD:254352 25/94 (27%)
IGc2 236..314 CDD:197706 21/77 (27%)
FN3 339..431 CDD:238020
zig-4NP_509335.1 I-set 47..147 CDD:254352 17/99 (17%)
Ig 65..144 CDD:143165 15/78 (19%)
IG_like 176..245 CDD:214653 21/77 (27%)
Ig <193..238 CDD:299845 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.