DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and zig-8

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:187 Identity:41/187 - (21%)
Similarity:72/187 - (38%) Gaps:32/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRY-VRWHR-DDVALVD------SRHPELPPPDR- 87
            |.|:......|.|.....:...|.|::.....: :.|.| .|.||:.      :|.|......: 
 Worm    33 ERSRVENPSQTIVNVVAENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKKS 97

  Fly    88 IMLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIF-- 150
            ..:|   .|.:...:..|:|.|.||:|.....|   :|:.:::....|..||.|.::....:.  
 Worm    98 ANIW---VLNLRRAEQQDSGCYLCEINDKHNTV---YAVYLKVLEPPLPSPSSLQKKSTKLMANM 156

  Fly   151 ---EVV--CEAQGVPQPV----ITWRLNGNVIQPQSNTGNRQSLILEIKSRNQAGLI 198
               |||  |......:..    :.|..:||.|    |..:.:..||::|  ..||::
 Worm   157 SGDEVVLNCTVTSTDKDEEVLDVVWTRDGNTI----NFNDTEKYILKVK--RDAGVV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845 20/91 (22%)
IG_like 41..118 CDD:214653 19/85 (22%)
IG_like 145..218 CDD:214653 14/65 (22%)
Ig 147..219 CDD:299845 14/63 (22%)
I-set 224..323 CDD:254352
IGc2 236..314 CDD:197706
FN3 339..431 CDD:238020
zig-8NP_499714.1 IG_like 55..134 CDD:214653 19/84 (23%)
Ig 55..129 CDD:143165 18/79 (23%)
ig 158..229 CDD:278476 14/56 (25%)
IG_like 158..227 CDD:214653 14/56 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.