DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Fgfrl1

DIOPT Version :9

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_473412.1 Gene:Fgfrl1 / 116701 MGIID:2150920 Length:529 Species:Mus musculus


Alignment Length:273 Identity:58/273 - (21%)
Similarity:93/273 - (34%) Gaps:104/273 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 RIGAIFEVVCEAQGVPQPVITWRLNGNVIQ---------PQSNTGNRQSLILEIK--SRNQAGLI 198
            |:|....:.|..:|.|.|:..|..:|..|.         ||.         |::|  ....||:.
Mouse    38 RLGRTVRLQCPVEGDPPPLTMWTKDGRTIHSGWSRFRVLPQG---------LKVKEVEAEDAGVY 93

  Fly   199 ECVASNGVGEPAVANVYLHVL--FSPEVSIPQP-----------------------------VVY 232
            .|.|:||.|..:| |..|.::  .||....|.|                             |:.
Mouse    94 VCKATNGFGSLSV-NYTLIIMDDISPGKESPGPGGSSGGQEDPASQQWARPRFTQPSKMRRRVIA 157

  Fly   233 TKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRH-----ML 292
            ..:||...|:|:....|...:.|                   ::.::::.| :.|..|     .|
Mouse   158 RPVGSSVRLKCVASGHPRPDIMW-------------------MKDDQTLTH-LEASEHRKKKWTL 202

  Fly   293 VVKSVRNADMGQYECRASNQISVKSGSVELT--------GRPMPCLFKINP--------GT---- 337
            .:|:::..|.|:|.||.||    |:|::..|        .|..|.|...:|        ||    
Mouse   203 SLKNLKPEDSGKYTCRVSN----KAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQ 263

  Fly   338 ---QSSTSHVLVW 347
               :|....|:.|
Mouse   264 CKVRSDVKPVIQW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 Ig 41..124 CDD:299845
IG_like 41..118 CDD:214653
IG_like 145..218 CDD:214653 23/83 (28%)
Ig 147..219 CDD:299845 22/82 (27%)
I-set 224..323 CDD:254352 23/132 (17%)
IGc2 236..314 CDD:197706 18/82 (22%)
FN3 339..431 CDD:238020 3/9 (33%)
Fgfrl1NP_473412.1 I-set 29..112 CDD:369462 23/83 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 4/34 (12%)
Ig2_FGFRL1-like 153..234 CDD:143264 22/104 (21%)
Ig 257..351 CDD:386229 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.