DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Opcml

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:357 Identity:87/357 - (24%)
Similarity:149/357 - (41%) Gaps:61/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IPTTV----------KTYENDTVQ------LPCTLNTPFRYVRW-HRDDVALVDSRHPELPPPDR 87
            :||.|          |..:|.||:      |.||::.....|.| :|..:....:....:.|  |
  Rat    25 VPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDP--R 87

  Fly    88 IMLWPNG----SLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGA 148
            :::..|.    |:.:.||...|.|.|.|.:.:|:.....:..:.||:.||::...||:|... |:
  Rat    88 VIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNE-GS 151

  Fly   149 IFEVVCEAQGVPQPVITWRLNGNVIQPQSNTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVAN 213
            ...::|.|.|.|:|.:||| :.:|.:.|......:.|.:....|:|:|..||.|.|.|..|.|..
  Rat   152 SVTLLCLAIGRPEPTVTWR-HLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRK 215

  Fly   214 VYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTN 278
            |.:.|.:.|.:|..:. ....:|.:..|.|...|.|.|..:||.....:|.|......|::.:.:
  Rat   216 VKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRIS 279

  Fly   279 RSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQ----- 338
                        .|...:|...|.|.|.|.|:|::...:.|:        .|::|:|.:.     
  Rat   280 ------------TLTFFNVSEKDYGNYTCVATNKLGNTNASI--------TLYEISPSSAVAGPG 324

  Fly   339 ------SSTSHVL--VWQTESLLPIMEFKLKF 362
                  :|.|..|  :|.:.:.  ...|.:||
  Rat   325 AVIDGVNSASRALACLWLSGTF--FAHFFIKF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 24/97 (25%)
Ig strand B 52..56 CDD:409353 2/9 (22%)
Ig strand C 64..68 CDD:409353 2/4 (50%)
Ig strand E 94..98 CDD:409353 1/7 (14%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 27/85 (32%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 1/2 (50%)
Ig_3 222..311 CDD:464046 20/88 (23%)
FN3 339..431 CDD:238020 7/26 (27%)
OpcmlXP_017450901.1 Ig 44..132 CDD:472250 20/89 (22%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 135..206 CDD:464046 23/72 (32%)
Ig 224..312 CDD:472250 22/108 (20%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/15 (7%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.