DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and ncam2

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 / 100151722 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis


Alignment Length:439 Identity:104/439 - (23%)
Similarity:193/439 - (43%) Gaps:68/439 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QVQAELDF-------NNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRYVRWHRDDVALVDS 77
            :|:.|:||       |...|...:.:|...|....|:.|:....| .:|..|:.|||:...:.::
 Frog   220 EVRGEIDFRDISVIVNVPPEILAQQRSFNATADRLEDITLFCRAT-GSPKPYITWHRNGKLVEEN 283

  Fly    78 RHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLT 142
            ...:|..       .|..|.|.|:.|:|:|.|.|...:.:|...:|..::|.:.|.::...::.|
 Frog   284 EKYDLRE-------DNTELTVKNIISTDSGLYVCRATNKAGFTEKQSFLQVFVQPHIVQLQNETT 341

  Fly   143 EQRIGAIFEVVCEAQGVPQPVITWR--------LNGNVIQPQ--SNTGNRQSLILEIKS--RNQA 195
            .:. |.: .:.|||:|.|.|.|||:        .:|:..|..  .:||:.....|.|||  .:.|
 Frog   342 IEH-GHV-TLTCEAEGEPIPEITWKRSSDGMIFYDGDKSQDGRIESTGHHGKSSLHIKSVMLSDA 404

  Fly   196 GLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGL 260
            |..:|.|::.:|... .::||::.::|:....|.:.|:...:..::.|.|.:.|.:::.|....|
 Frog   405 GRYDCEAASRIGGHQ-KSMYLNIEYAPKFISNQTIYYSWENNPINISCDVTSNPPSSIYWSRDKL 468

  Fly   261 PVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGR 325
              .|.|.:.|         ::..|.:..|.:|.:..:.:.|.|:|.|.|.|.|..:.....||..
 Frog   469 --LLPARNIT---------NIKTYRDGKRILLEITPLSDNDFGRYNCTAINSIGSRIQEYILTLA 522

  Fly   326 PMPCLFKINP----GTQSSTSHVLVW----QTESLLPIMEFKLKFRQIPSNNVTRQVRTNWTELT 382
            .:|.    :|    ..:.|.::..|:    .:...:||..:::.|::: |:.:.:.||::.|:  
 Frog   523 DVPS----SPYGLRVIELSQTYAKVFFNKPDSHGGVPIHHYQMDFKEV-SSEIWKVVRSHGTQ-- 580

  Fly   383 IPAQATNGLIYITTYTLHGLQPASLYEVSVLARNSFGWSDNSKIVRFAT 431
                        |...|..|...:.|||.|.|.|..|..:.||...|.|
 Frog   581 ------------TIIVLGNLDANTTYEVKVAAVNGKGKGEYSKTEIFQT 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 19/76 (25%)
Ig strand B 52..56 CDD:409353 0/3 (0%)
Ig strand C 64..68 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 133..219 CDD:472250 26/97 (27%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 2/3 (67%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 19/88 (22%)
FN3 339..431 CDD:238020 22/95 (23%)
ncam2XP_012811963.1 Ig 50..142 CDD:472250
Ig strand B 67..71 CDD:409452
Ig strand C 79..83 CDD:409452
Ig strand E 105..109 CDD:409452
Ig strand F 119..124 CDD:409452
Ig strand G 133..136 CDD:409452
IG_like 150..234 CDD:214653 4/13 (31%)
Ig strand B 161..165 CDD:409353
Ig strand C 174..178 CDD:409353
Ig strand E 198..202 CDD:409353
Ig strand F 212..217 CDD:409353
Ig 238..327 CDD:472250 23/96 (24%)
Ig strand B 257..261 CDD:409301 1/3 (33%)
Ig strand C 270..274 CDD:409301 1/3 (33%)
Ig strand E 293..297 CDD:409301 1/3 (33%)
Ig strand F 307..312 CDD:409301 2/4 (50%)
Ig strand G 320..323 CDD:409301 0/2 (0%)
Ig 329..426 CDD:472250 27/99 (27%)
Ig strand B 347..351 CDD:143278 0/4 (0%)
Ig strand C 360..364 CDD:143278 2/3 (67%)
Ig strand E 392..396 CDD:143278 1/3 (33%)
Ig strand F 406..411 CDD:143278 1/4 (25%)
Ig strand G 419..422 CDD:143278 0/3 (0%)
Ig_3 430..508 CDD:464046 19/88 (22%)
FN3 525..617 CDD:238020 24/110 (22%)
fn3 623..707 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.