| Sequence 1: | NP_477404.1 | Gene: | wrapper / 37555 | FlyBaseID: | FBgn0025878 | Length: | 500 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
| Alignment Length: | 337 | Identity: | 89/337 - (26%) |
|---|---|---|---|
| Similarity: | 139/337 - (41%) | Gaps: | 48/337 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 CLL-AALILGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRYVRW-HRDDVA 73
Fly 74 LVDSRHPELPPPDRIMLWPNG----SLQVANVQSSDTGDYYCEMNSD-SGHVVQQHAIEVQLAPQ 133
Fly 134 VLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNT-GNRQSLILEIKSRNQAGL 197
Fly 198 IECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPV 262
Fly 263 ALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPM 327
Fly 328 PCLFKINPGTQS 339 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wrapper | NP_477404.1 | Ig | 41..124 | CDD:299845 | 19/88 (22%) |
| IG_like | 41..118 | CDD:214653 | 17/82 (21%) | ||
| IG_like | 145..218 | CDD:214653 | 26/73 (36%) | ||
| Ig | 147..219 | CDD:299845 | 26/72 (36%) | ||
| I-set | 224..323 | CDD:254352 | 22/98 (22%) | ||
| IGc2 | 236..314 | CDD:197706 | 19/77 (25%) | ||
| FN3 | 339..431 | CDD:238020 | 1/1 (100%) | ||
| negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 20/95 (21%) |
| FR1 | 44..62 | CDD:409353 | 3/18 (17%) | ||
| Ig strand A' | 47..53 | CDD:409353 | 1/6 (17%) | ||
| Ig strand B | 55..63 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 63..68 | CDD:409353 | 1/4 (25%) | ||
| FR2 | 69..75 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C | 69..74 | CDD:409353 | 1/4 (25%) | ||
| CDR2 | 76..87 | CDD:409353 | 0/10 (0%) | ||
| Ig strand C' | 78..82 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 88..122 | CDD:409353 | 10/35 (29%) | ||
| Ig strand D | 91..98 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 101..107 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 123..127 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 127..136 | CDD:409353 | 2/9 (22%) | ||
| FR4 | 129..136 | CDD:409353 | 2/7 (29%) | ||
| Ig_3 | 140..208 | CDD:404760 | 25/72 (35%) | ||
| Ig strand A' | 146..151 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 157..164 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 170..175 | CDD:409353 | 3/8 (38%) | ||
| Ig strand C' | 177..179 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 187..193 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 200..207 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 214..222 | CDD:409353 | 2/7 (29%) | ||
| Ig_3 | 226..302 | CDD:404760 | 21/88 (24%) | ||
| putative Ig strand A | 226..232 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 242..246 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 281..285 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 295..300 | CDD:409353 | 2/4 (50%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||