DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtf1 and tplus3a

DIOPT Version :9

Sequence 1:NP_001286717.1 Gene:Rtf1 / 37554 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_724373.1 Gene:tplus3a / 318904 FlyBaseID:FBgn0051702 Length:441 Species:Drosophila melanogaster


Alignment Length:464 Identity:124/464 - (26%)
Similarity:203/464 - (43%) Gaps:71/464 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 ERSKERKKNVEANKTDDKRSNAMALLKAKRE---GKAKREEEEAKRMAEKDRDDDKEELDSVSGC 372
            ||.:.|:|.....::..|.::|...|.|.|.   .|.|..|:.|::  .|..||.|.:      .
  Fly     3 ERLRTRRKIANKLESGGKTAHAFERLLAIRTIKLSKGKCSEDSAEQ--TKSSDDCKAQ------T 59

  Fly   373 KSAVKLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEKAPQRPVFITTREDLNKL 437
            :..|.::..|.||.||..:  .|.|..|     .|..:.:.|||:.         ::..|.|::.
  Fly    60 RKDVNIEVKETYSGDSSPN--SESENTA-----QNDPQMNVESEER---------VSNLEQLSRA 108

  Fly   438 RLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLR 502
            .|.|..::..:..|||...|:..||||::|.     ||.:.|.:.:.:..|.|.:...|||..|.
  Fly   109 VLKRNDIKNLLGKPIFAEAVIGSFVRINVGK-----VYSIYETIALHQDSKDYRVDGKRTNLTLV 168

  Fly   503 LKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDV 567
            |:.|:::|..|::.:|||..|:.||..|.|...::...:||::.||.||..:|.|..|.:.:.||
  Fly   169 LRCGSEKRYSRIDVVSNQPITQKEFLLWLETNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDV 233

  Fly   568 DKIVEEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDEL-ENRASELDKRRSHT 631
            :|::::|.. .....|.|.:|..|:.|||.|....|.:..|.|.::|.|: |....:::|...|.
  Fly   234 EKLIQDKKE-AGIKQNAAYRKISLIIERDMAAGMNDVEKVQVLEKKILEIDEEPRPQIEKSGQHR 297

  Fly   632 LNLISYINDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQP------------------- 677
            ..::|    ..|..:|....:   .|.....|.|.|  |.:|..:|                   
  Fly   298 YQVLS----STRGVHVPTIYR---HELGVPSGGKSS--FVKRTAKPEQHELEKYMRRKYKKSAVV 353

  Fly   678 -RMGFKGAKKD--EDDMQLAPLPPPPPGKKRPNEAGTSSASVRSTDSKDYSLYSLHDFDIDLDVP 739
             |..||.|.:|  :....:..:......|:...|..|.:.:.:.|: ||..|..||.|:|:||  
  Fly   354 SRSRFKKAFEDCVDSSAVVNDIHMESQQKEGDVETETETETEKGTE-KDLHLQRLHTFNIELD-- 415

  Fly   740 LPVNTNSVP 748
               .|..||
  Fly   416 ---TTGLVP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 34/106 (32%)
tplus3aNP_724373.1 Plus-3 105..198 CDD:281165 32/97 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4203
eggNOG 1 0.900 - - E1_COG5296
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3579
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.