DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtf1 and CG12498

DIOPT Version :9

Sequence 1:NP_001286717.1 Gene:Rtf1 / 37554 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_570030.1 Gene:CG12498 / 31272 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster


Alignment Length:330 Identity:77/330 - (23%)
Similarity:120/330 - (36%) Gaps:91/330 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 LKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEKAPQRPVFITTREDLNKLRLSRY 442
            |:||.:..||...|..:..|||                    ..|..||  |:|:.|..|||||:
  Fly    23 LRASPLRIDDENESWVNGYEKP--------------------PTPDLPV--TSRDQLELLRLSRH 65

  Fly   443 KMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHGT 507
            ::...:..|.||..|..||||:::...|:.|.:|:||::|:.|....|.:....||..|||::..
  Fly    66 RIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRIAEVLGICELDFGYKVEQIPTNVALRLRYDD 130

  Fly   508 QERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIVE 572
            .|....:..:||..||:.||..|.:.|....:..||..::..|:.::..||..|.|..   .:::
  Fly   131 LEMQHEINDVSNLNFTQEEFELWRDNCVNQAISPPTTHILTRKKVELYNALQLEAKPL---SLIQ 192

  Fly   573 EKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISY 637
            ....|..||.                             |:|..:|........:.:|:|..:|.
  Fly   193 RTFSFALRPQ-----------------------------QKIGIMERHGVVYPWQLNHSLPFVSQ 228

  Fly   638 INDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQPRMGFKGAKKDEDDMQLAPLPPPPPG 702
            ....|..:...|.                                 ..::||....|||.|    
  Fly   229 SPTENPSRGKADT---------------------------------VDEEEDPGAAAPLLP---- 256

  Fly   703 KKRPN 707
            |..||
  Fly   257 KTEPN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 37/106 (35%)
CG12498NP_570030.1 Plus3 51..157 CDD:197843 38/107 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4203
eggNOG 1 0.900 - - E1_COG5296
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003630
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.