| Sequence 1: | NP_477049.2 | Gene: | Gp150 / 37549 | FlyBaseID: | FBgn0013272 | Length: | 1076 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001038237.1 | Gene: | si:dkey-90m5.4 / 553466 | ZFINID: | ZDB-GENE-041014-250 | Length: | 327 | Species: | Danio rerio |
| Alignment Length: | 247 | Identity: | 78/247 - (31%) |
|---|---|---|---|
| Similarity: | 109/247 - (44%) | Gaps: | 27/247 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 419 INLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLSILHLKYNTFNGDLHFGTKD 483
Fly 484 LQQLDLSFNSIVQVHHSMFDKMPGLTNLNLKGNGIKKIQPDSFLTLKNLRHIDLSINDLDQISGM 548
Fly 549 LFFKNSELDVIRLNDNPRLSQLPTDGFLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHLTTLKL 613
Fly 614 AWNNINHLPREIFTGLHKLIDLDLSNNLITRMDDLIFMDNGELTKLSLAGNP 665 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gp150 | NP_477049.2 | LRR_8 | 317..377 | CDD:290566 | |
| leucine-rich repeat | 343..366 | CDD:275380 | |||
| leucine-rich repeat | 367..391 | CDD:275380 | |||
| LRR_RI | <374..619 | CDD:238064 | 63/199 (32%) | ||
| LRR_8 | 390..450 | CDD:290566 | 10/30 (33%) | ||
| leucine-rich repeat | 393..415 | CDD:275380 | |||
| leucine-rich repeat | 416..439 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 440..483 | CDD:275380 | 14/42 (33%) | ||
| leucine-rich repeat | 463..481 | CDD:275380 | 3/17 (18%) | ||
| LRR_8 | 484..542 | CDD:290566 | 23/57 (40%) | ||
| leucine-rich repeat | 484..507 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 508..531 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 532..569 | CDD:275380 | 10/36 (28%) | ||
| leucine-rich repeat | 556..583 | CDD:275380 | 8/26 (31%) | ||
| leucine-rich repeat | 570..607 | CDD:275380 | 13/36 (36%) | ||
| LRR_RI | <586..745 | CDD:238064 | 28/80 (35%) | ||
| LRR_8 | 606..666 | CDD:290566 | 19/60 (32%) | ||
| leucine-rich repeat | 608..631 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 632..655 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 656..674 | CDD:275380 | 3/10 (30%) | ||
| leucine-rich repeat | 733..745 | CDD:275378 | |||
| si:dkey-90m5.4 | NP_001038237.1 | LRR_8 | 55..115 | CDD:404697 | 22/74 (30%) |
| leucine-rich repeat | 57..80 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 81..104 | CDD:275380 | 12/29 (41%) | ||
| PPP1R42 | 102..279 | CDD:411060 | 61/196 (31%) | ||
| leucine-rich repeat | 105..126 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 128..151 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 152..175 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 176..199 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 200..223 | CDD:275380 | 9/24 (38%) | ||
| leucine-rich repeat | 224..247 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 248..271 | CDD:275380 | 7/22 (32%) | ||
| TPKR_C2 | 278..319 | CDD:417692 | 2/2 (100%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45617 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||