DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gp150 and Tollo

DIOPT Version :9

Sequence 1:NP_477049.2 Gene:Gp150 / 37549 FlyBaseID:FBgn0013272 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:584 Identity:139/584 - (23%)
Similarity:235/584 - (40%) Gaps:167/584 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 MGPNFFQNLGLKNVASIKIANCTLEY-----LHAEAFHGLNELYAVNLT---------------- 349
            :.|:.|::|       :::.:.|:||     |...:|.||.||.  |||                
  Fly    89 LSPDSFRSL-------VELRDLTIEYCKLGNLTDGSFRGLQELR--NLTIRTHNGDWSTMSLEMA 144

  Fly   350 -----------DVGLAIIN----PDTFV-GNKKLRMLTISGNDLSVMSSIHYLLKSSS------- 391
                       .:.|::.|    ||..| ..|.|:.|..|.|.:..:|:.::....||       
  Fly   145 SNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQHLNASYNKIQDISNFYFSASLSSRKARVCG 209

  Fly   392 --IEELDFSRNNLMELNPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELP 454
              ::.||.|.|.::.|.....|.|..:.::|:::||:..|.::|||.:..|..:|||.|.||.||
  Fly   210 STLQSLDLSANKMVSLPTAMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLSANRLTSLP 274

  Fly   455 RDIFNGT-TLSILHLKYNTFN-------GDL----------------------HFGTKDLQQLDL 489
            .::|..| .|..::|:.|:.|       |:|                      ..|.|.|..|||
  Fly   275 PELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDL 339

  Fly   490 SFNSIVQVHHSMF----------------DKMPG-----LTNLN---LKGNGIKKIQPDSFLTLK 530
            |.|.|.::...:|                |::||     ||||:   |..|.|..|:..:...||
  Fly   340 SANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQGLK 404

  Fly   531 NLRHIDLSINDLDQISGMLFFKNSELDVIRLNDNPRLSQLPTDGFLSYSGEFTVYYLDISNCAIG 595
            ||..:.|..|.:.::........|:|..:.|||| :|..:|.    :.:....:..||:....|.
  Fly   405 NLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDN-KLQAVPE----ALAHVQLLKTLDVGENMIS 464

  Fly   596 PLGHKAFSTMPHLTTLKLAWNNINHLPREIFTGLHKLIDLDLSNNLITRMDDLIFMDNGELTKLS 660
            .:.:.:.:.:..|..|::..|::.|:.|.:|..:..|..|:||.|.:..::......|.:|..:.
  Fly   465 QIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNSQLQAIR 529

  Fly   661 LAGNPISRLSVRLFLPLHQ----------------------LRCLDVNDCELTTLLSDRDLGAGY 703
            |.||.:..:: .||..|..                      |:.|||....:|      .||..:
  Fly   530 LDGNQLKSIA-GLFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRIT------QLGNYF 587

  Fly   704 KIFD--SLRSFNASGNLIKKISSEDVKS--------------------FK--NLRSLDITNNPL 743
            :|..  ||.:|:||.||:.:|::..:.:                    ||  ||..:|:..|.|
  Fly   588 EIESELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRL 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gp150NP_477049.2 LRR_8 317..377 CDD:290566 22/96 (23%)
leucine-rich repeat 343..366 CDD:275380 9/54 (17%)
leucine-rich repeat 367..391 CDD:275380 5/23 (22%)
LRR_RI <374..619 CDD:238064 76/307 (25%)
LRR_8 390..450 CDD:290566 21/68 (31%)
leucine-rich repeat 393..415 CDD:275380 7/21 (33%)
leucine-rich repeat 416..439 CDD:275380 7/22 (32%)
leucine-rich repeat 440..483 CDD:275380 18/72 (25%)
leucine-rich repeat 463..481 CDD:275380 6/46 (13%)
LRR_8 484..542 CDD:290566 25/81 (31%)
leucine-rich repeat 484..507 CDD:275380 9/38 (24%)
leucine-rich repeat 508..531 CDD:275380 9/25 (36%)
leucine-rich repeat 532..569 CDD:275380 10/36 (28%)
leucine-rich repeat 556..583 CDD:275380 7/26 (27%)
leucine-rich repeat 570..607 CDD:275380 4/36 (11%)
LRR_RI <586..745 CDD:238064 45/204 (22%)
LRR_8 606..666 CDD:290566 16/59 (27%)
leucine-rich repeat 608..631 CDD:275380 6/22 (27%)
leucine-rich repeat 632..655 CDD:275380 6/22 (27%)
leucine-rich repeat 656..674 CDD:275380 4/17 (24%)
leucine-rich repeat 733..745 CDD:275378 4/11 (36%)
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 52/200 (26%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..144 CDD:275380 4/21 (19%)
LRR_8 152..222 CDD:290566 17/69 (25%)
leucine-rich repeat 154..177 CDD:275380 5/22 (23%)
leucine-rich repeat 178..201 CDD:275380 5/22 (23%)
LRR 210..656 CDD:227223 111/454 (24%)
leucine-rich repeat 212..235 CDD:275380 7/22 (32%)
leucine-rich repeat 236..259 CDD:275380 7/22 (32%)
leucine-rich repeat 260..283 CDD:275380 11/22 (50%)
LRR_RI 276..558 CDD:238064 65/287 (23%)
leucine-rich repeat 284..307 CDD:275380 6/22 (27%)
leucine-rich repeat 308..333 CDD:275380 1/24 (4%)
leucine-rich repeat 334..357 CDD:275380 8/22 (36%)
leucine-rich repeat 358..381 CDD:275380 4/22 (18%)
leucine-rich repeat 382..405 CDD:275380 6/22 (27%)
leucine-rich repeat 406..429 CDD:275380 3/22 (14%)
leucine-rich repeat 430..452 CDD:275380 7/26 (27%)
leucine-rich repeat 453..500 CDD:275380 9/46 (20%)
leucine-rich repeat 501..521 CDD:275380 5/19 (26%)
leucine-rich repeat 525..547 CDD:275380 7/22 (32%)
leucine-rich repeat 548..573 CDD:275380 1/24 (4%)
leucine-rich repeat 604..640 CDD:275380 4/35 (11%)
leucine-rich repeat 641..688 CDD:275380 4/11 (36%)
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.