DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gp150 and CG7800

DIOPT Version :9

Sequence 1:NP_477049.2 Gene:Gp150 / 37549 FlyBaseID:FBgn0013272 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster


Alignment Length:504 Identity:119/504 - (23%)
Similarity:192/504 - (38%) Gaps:115/504 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 CTLEYLH----AEAFHGLNELYAVNLTDVGLAIINPDTFVGNKKLRMLTISGND-----LSVMSS 382
            |...|.|    :..|   ::..|..||:..:.............||.|.:...|     ::.::.
  Fly    24 CNDSYCHLLGRSRTF---SDKKATKLTEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQ 85

  Fly   383 IHYLLKSSSIEELDFSRNNLMELNPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSY 447
            :.||      ..|...|.||:.|:.:.||...|:..:.|..|::.:|..:.|:.:..|..|.|..
  Fly    86 LPYL------TSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPG 144

  Fly   448 NSLTELPRDIFNGTTLSILHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKMPGLTNLN 512
            |.:..||.|:|.... .:||                   ||||.|.|..:|.::|..:|.|..|.
  Fly   145 NGIQGLPWDVFQNLP-ELLH-------------------LDLSGNRIETLHENIFTGVPKLEMLL 189

  Fly   513 LKGNGIKKIQPDSFLTLKNLRHIDLSINDLDQISGMLFFKNSELDVIRLNDNPRLSQLPTDG--- 574
            |.||.:..|.|.|..:|.|||.:|:|                       |..| |..|...|   
  Fly   190 LNGNPLTWIAPTSLKSLSNLRLLDMS-----------------------NCGP-LPDLSLPGAHT 230

  Fly   575 -FLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHLTTLKL----------AWNNI---NHLPREI 625
             .|..||   |..|||    :|.: ||..:...|:|.:||          ..:|:   ..:|: :
  Fly   231 LILDNSG---VQRLDI----LGSV-HKLQARKNHITEIKLPDKSSVIELDLHSNLLTATDIPK-L 286

  Fly   626 FTGLHKLIDLDLSNNLI--------TRMDDLIFMDNGELTKLSLAGNPISRLSVRLFLPLHQLRC 682
            .||:.:|..||||.|:|        ....:|..:.|  |..::|:.|.::||.....:|..:|..
  Fly   287 LTGMWRLQRLDLSENIIGIYAAAGSDNTSELFILPN--LMYMNLSANRLTRLHFDSPIPWERLTH 349

  Fly   683 LDVNDCELTTLLSDRDLGAGYKIFDSLRSFNASGNLIKKISSEDVKSFKNLRSLDITNNPLK--- 744
            ||.:   ...:.:...:|.....  :|:|.:..||.|........|...:|:.:.:.:|..:   
  Fly   350 LDAS---YNRIYAPAKVGIDEAF--NLQSLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKG 409

  Fly   745 ---CTPDFQEFISYVTLQMQ------MTPKRLPVLANLEDDATIVQLET 784
               .|..|.|....|..:.|      .||...|.:.:..|..|.:..:|
  Fly   410 YKNITKFFNEIGVNVLEKTQYSQSNNTTPTCKPCIPDARDFPTSISADT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gp150NP_477049.2 LRR_8 317..377 CDD:290566 11/58 (19%)
leucine-rich repeat 343..366 CDD:275380 3/22 (14%)
leucine-rich repeat 367..391 CDD:275380 6/28 (21%)
LRR_RI <374..619 CDD:238064 68/266 (26%)
LRR_8 390..450 CDD:290566 16/59 (27%)
leucine-rich repeat 393..415 CDD:275380 7/21 (33%)
leucine-rich repeat 416..439 CDD:275380 4/22 (18%)
leucine-rich repeat 440..483 CDD:275380 10/42 (24%)
leucine-rich repeat 463..481 CDD:275380 2/17 (12%)
LRR_8 484..542 CDD:290566 23/57 (40%)
leucine-rich repeat 484..507 CDD:275380 8/22 (36%)
leucine-rich repeat 508..531 CDD:275380 9/22 (41%)
leucine-rich repeat 532..569 CDD:275380 7/36 (19%)
leucine-rich repeat 556..583 CDD:275380 8/30 (27%)
leucine-rich repeat 570..607 CDD:275380 12/40 (30%)
LRR_RI <586..745 CDD:238064 41/185 (22%)
LRR_8 606..666 CDD:290566 20/80 (25%)
leucine-rich repeat 608..631 CDD:275380 7/35 (20%)
leucine-rich repeat 632..655 CDD:275380 9/30 (30%)
leucine-rich repeat 656..674 CDD:275380 5/17 (29%)
leucine-rich repeat 733..745 CDD:275378 2/17 (12%)
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 2/17 (12%)
leucine-rich repeat 65..85 CDD:275380 4/19 (21%)
LRR_8 87..147 CDD:290566 18/65 (28%)
leucine-rich repeat 89..112 CDD:275380 8/28 (29%)
leucine-rich repeat 113..136 CDD:275380 4/22 (18%)
LRR_RI <131..334 CDD:238064 69/257 (27%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 23/74 (31%)
leucine-rich repeat 161..184 CDD:275380 10/41 (24%)
leucine-rich repeat 185..208 CDD:275380 9/22 (41%)
leucine-rich repeat 209..246 CDD:275380 16/67 (24%)
leucine-rich repeat 247..267 CDD:275380 6/20 (30%)
leucine-rich repeat 268..292 CDD:275380 4/24 (17%)
leucine-rich repeat 293..322 CDD:275380 8/28 (29%)
leucine-rich repeat 395..406 CDD:275378 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.