DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gp150 and CG4781

DIOPT Version :9

Sequence 1:NP_477049.2 Gene:Gp150 / 37549 FlyBaseID:FBgn0013272 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster


Alignment Length:350 Identity:86/350 - (24%)
Similarity:144/350 - (41%) Gaps:71/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 LEELDLSYNSLTELPRDIFNGTTLSILHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDK 504
            ::.||||:|:|..:|                 .|..|      .|.||:|..|:|.|:....|.:
  Fly    88 IDSLDLSWNALDSVP-----------------IFTSD------SLHQLNLRHNNISQLVSGNFKQ 129

  Fly   505 MPGLTNLNLKGNGIKKIQPDSFLTLKNLRHIDLSINDLDQISGMLFFKNSELDVIRLNDNPRLSQ 569
            :..|..|.|..|.|.|::..||..|.:|:.:||:.|:|..:.|.||.....|..:.::.|.|.::
  Fly   130 LTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNRRFNE 194

  Fly   570 LPTDGFLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHLTTLKLAWNNINHLPREIFTGLHKLID 634
            ...|.:......:.:..|.:..|::..| |...:.  .|..|.|..|.:..:|.::   ...|:.
  Fly   195 SGGDLYTGLGVNWKLSTLRLDACSLNDL-HLPVNA--PLKELSLRRNQLKRIPTQL---PETLLR 253

  Fly   635 LDLSNNLITRMDDLIFMDNGELTKL------------SLAGNPISRLSVRLFLPLHQLRCLDVND 687
            ||:|:||   :::|:..|...||::            .:..|.::.:.|...|.....|.|...|
  Fly   254 LDISDNL---LEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVLETLSFQNSRQLSHLD 315

  Fly   688 CE-----LTTLLSDRDLGAGYKIFDSLRSFNASGNLIKKISSEDVKSFKNLRSLDITNNPLKCTP 747
            .|     :||....|          :|||.:..|.:::..:|.....|..|..||:...||:|..
  Fly   316 AEAFGPIMTTPTKKR----------ALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQCDC 370

  Fly   748 DFQEFISYVTLQMQMTPKRLPVLAN 772
            :.      |.|      |:|||..|
  Fly   371 EL------VWL------KQLPVQTN 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gp150NP_477049.2 LRR_8 317..377 CDD:290566
leucine-rich repeat 343..366 CDD:275380
leucine-rich repeat 367..391 CDD:275380
LRR_RI <374..619 CDD:238064 46/178 (26%)
LRR_8 390..450 CDD:290566 5/9 (56%)
leucine-rich repeat 393..415 CDD:275380
leucine-rich repeat 416..439 CDD:275380
leucine-rich repeat 440..483 CDD:275380 9/42 (21%)
leucine-rich repeat 463..481 CDD:275380 2/17 (12%)
LRR_8 484..542 CDD:290566 21/57 (37%)
leucine-rich repeat 484..507 CDD:275380 8/22 (36%)
leucine-rich repeat 508..531 CDD:275380 9/22 (41%)
leucine-rich repeat 532..569 CDD:275380 11/36 (31%)
leucine-rich repeat 556..583 CDD:275380 4/26 (15%)
leucine-rich repeat 570..607 CDD:275380 5/36 (14%)
LRR_RI <586..745 CDD:238064 40/175 (23%)
LRR_8 606..666 CDD:290566 16/71 (23%)
leucine-rich repeat 608..631 CDD:275380 5/22 (23%)
leucine-rich repeat 632..655 CDD:275380 8/22 (36%)
leucine-rich repeat 656..674 CDD:275380 4/29 (14%)
leucine-rich repeat 733..745 CDD:275378 5/11 (45%)
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 9/40 (23%)
LRR_8 108..167 CDD:290566 21/58 (36%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR_RI <121..>261 CDD:238064 38/148 (26%)
leucine-rich repeat 133..156 CDD:275380 9/22 (41%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
leucine-rich repeat 181..208 CDD:275380 4/26 (15%)
leucine-rich repeat 230..253 CDD:275380 6/25 (24%)
leucine-rich repeat 254..274 CDD:275380 8/22 (36%)
leucine-rich repeat 275..299 CDD:275380 1/23 (4%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.