DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gp150 and 18w

DIOPT Version :9

Sequence 1:NP_477049.2 Gene:Gp150 / 37549 FlyBaseID:FBgn0013272 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster


Alignment Length:531 Identity:130/531 - (24%)
Similarity:214/531 - (40%) Gaps:118/531 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 PNFFQNL-GLKNVASIKIANC------TLEYLHAEAFHGLNELYAVNLTD--------------- 350
            ||.|:.| .||.: :::..|.      ||| ||.::|.||.||..::|.|               
  Fly   107 PNAFEGLMSLKRL-TLESHNAVWGPGKTLE-LHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMP 169

  Fly   351 -------------------------VGLAIINPDTFV-GNKKLRMLTISGNDLSVMSSIHYLLKS 389
                                     .|.|:.|.:..| |..:|:.|.:|.|:|..:.......:.
  Fly   170 SLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRL 234

  Fly   390 SSIEELDFSRNNLMELNPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELP 454
            ..::.|....||:..|.|.|.:.||::..:|:|.|.|..||.:||.....|.||.|..|.|.|||
  Fly   235 RRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELP 299

  Fly   455 RDI-----------FNGTTLSILHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKMPGL 508
            :.:           .:|..|:..|:..:||.|.:.     |..|:||.|::.::....|.::..|
  Fly   300 KGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIR-----LIVLNLSNNALTRIGSKTFKELYFL 359

  Fly   509 TNLNLKGNGIKKIQPDSFLTLKNLRHIDLSINDLDQISGMLFFKNSELDVIRLNDNPRLSQLPTD 573
            ..|:::.|.|..|:..:||.|.||..::|:.|.|..:...:|                       
  Fly   360 QILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIF----------------------- 401

  Fly   574 GFLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHLTTLKLAWNNINHLPREIFTGLHKLIDLDLS 638
                 :|.:.:..|.::|..:..:..:||.....|..|.|:.|.:..:| |....|..|..|||.
  Fly   402 -----NGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEVP-EAVQDLSMLKTLDLG 460

  Fly   639 NNLITRMDDLIFMDNGELTKLSLAGNPISRLSVRLFLPLHQLRCLDV--------------NDCE 689
            .|.|:...:..|.:..:||.|.|..|.|..::|.:|..|.:|..|::              .:.|
  Fly   461 ENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTE 525

  Fly   690 LTTLLSDR----DLGAGYKIFDSLRSFNASGNLIKKISSEDVKSFKNLRSLDITNNPLKCTPDF- 749
            :..:..|:    |:...:....||...|.|.|.:.......:.|  ||:.|||..|.::...:: 
  Fly   526 IEAIRLDKNFLTDINGIFATLASLLWLNLSENHLVWFDYAFIPS--NLKWLDIHGNYIEALGNYY 588

  Fly   750 --QEFISYVTL 758
              ||.|...||
  Fly   589 KLQEEIRVTTL 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gp150NP_477049.2 LRR_8 317..377 CDD:290566 23/106 (22%)
leucine-rich repeat 343..366 CDD:275380 8/63 (13%)
leucine-rich repeat 367..391 CDD:275380 5/23 (22%)
LRR_RI <374..619 CDD:238064 62/255 (24%)
LRR_8 390..450 CDD:290566 21/59 (36%)
leucine-rich repeat 393..415 CDD:275380 7/21 (33%)
leucine-rich repeat 416..439 CDD:275380 8/22 (36%)
leucine-rich repeat 440..483 CDD:275380 15/53 (28%)
leucine-rich repeat 463..481 CDD:275380 5/17 (29%)
LRR_8 484..542 CDD:290566 18/57 (32%)
leucine-rich repeat 484..507 CDD:275380 6/22 (27%)
leucine-rich repeat 508..531 CDD:275380 8/22 (36%)
leucine-rich repeat 532..569 CDD:275380 5/36 (14%)
leucine-rich repeat 556..583 CDD:275380 1/26 (4%)
leucine-rich repeat 570..607 CDD:275380 5/36 (14%)
LRR_RI <586..745 CDD:238064 44/176 (25%)
LRR_8 606..666 CDD:290566 19/59 (32%)
leucine-rich repeat 608..631 CDD:275380 7/22 (32%)
leucine-rich repeat 632..655 CDD:275380 7/22 (32%)
leucine-rich repeat 656..674 CDD:275380 7/17 (41%)
leucine-rich repeat 733..745 CDD:275378 5/11 (45%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380 4/7 (57%)
LRR_8 115..181 CDD:290566 15/67 (22%)
leucine-rich repeat 116..146 CDD:275380 11/31 (35%)
leucine-rich repeat 147..170 CDD:275380 3/22 (14%)
leucine-rich repeat 171..201 CDD:275380 2/29 (7%)
LRR_RI 210..464 CDD:238064 73/287 (25%)
leucine-rich repeat 212..236 CDD:275380 5/23 (22%)
LRR_8 235..295 CDD:290566 21/59 (36%)
leucine-rich repeat 237..260 CDD:275380 7/22 (32%)
leucine-rich repeat 261..284 CDD:275380 8/22 (36%)
LRR_8 283..345 CDD:290566 20/66 (30%)
leucine-rich repeat 285..308 CDD:275380 9/22 (41%)
leucine-rich repeat 309..334 CDD:275380 6/24 (25%)
LRR_8 334..393 CDD:290566 18/63 (29%)
leucine-rich repeat 335..358 CDD:275380 6/22 (27%)
leucine-rich repeat 359..382 CDD:275380 8/22 (36%)
LRR_8 382..441 CDD:290566 15/86 (17%)
leucine-rich repeat 383..406 CDD:275380 6/50 (12%)
leucine-rich repeat 407..430 CDD:275380 4/22 (18%)
LRR_8 431..488 CDD:290566 19/57 (33%)
leucine-rich repeat 431..451 CDD:275380 6/20 (30%)
leucine-rich repeat 454..477 CDD:275380 7/22 (32%)
LRR_8 477..559 CDD:290566 19/81 (23%)
leucine-rich repeat 478..499 CDD:275380 8/20 (40%)
leucine-rich repeat 502..525 CDD:275380 2/22 (9%)
leucine-rich repeat 526..548 CDD:275380 2/21 (10%)
leucine-rich repeat 590..617 CDD:275380 5/10 (50%)
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.